Clone RH61753 Report

Search the DGRC for RH61753

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:617
Well:53
Vector:pFlc-1
Associated Gene/TranscriptCG41128-RB
Protein status:RH61753.pep: gold
Sequenced Size:325

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12453 2002-01-01 Sim4 clustering to Release 2
CG41128 2008-04-29 Release 5.5 accounting
CG41128 2008-08-15 Release 5.9 accounting
CG41128 2008-12-18 5.12 accounting

Clone Sequence Records

RH61753.complete Sequence

325 bp (325 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071755

> RH61753.complete
GAATTTTTTAAGTCCTTTTAACGTTGTTTTGGCAATAAAAATGACTTCTC
GCGATAATATTTTCGAGGAAAAAATATGCAATAGATTAGATCATTGCGTT
TCTGATGTATTAATTAAAGGATGTGGAGGCGTAATTATTGGATCTGCTGT
ATCTTTCTTAATTTTAAAGAGACGAGCATGGCCTGTATGGCTCGGCGCTG
GATTTGGAATGGGCATCGCTTATAGGACGTGTGAAAAGGATTTAAATTCT
TTAAAATAAAGATTATTACCTTTTAATTCAAATAAAATATTTAATTGAGT
AATGAAAATAAAAAAAAAAAAAAAA

RH61753.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG41128-RB 321 CG41128-RB 14..321 2..309 1540 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3RHet 2517486 chr3RHet 1806522..1806708 309..123 935 100 Minus
chr3RHet 2517486 chr3RHet 1808333..1808456 125..2 620 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 3752167..3752355 123..311 945 100 Plus
3R 32079331 3R 3750419..3750542 2..125 620 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 3413605..3413793 123..311 945 100 Plus
3R 31820162 3R 3411857..3411980 2..125 620 100 Plus
Blast to na_te.dros performed 2019-03-16 14:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 300..354 229..283 104 65.5 Plus
gypsy5 7369 gypsy5 GYPSY5 7369bp 7239..7293 229..283 104 65.5 Plus
transib1 2167 transib1 TRANSIB1 2167bp 1892..1960 242..307 104 63.8 Plus

RH61753.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:39:50 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
chr3RHet 1806592..1806708 123..239 100 <- Minus
chr3RHet 1808336..1808456 1..122 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:51:22 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
CG41128-RA 1..258 2..259 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:30 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
CG41128-RB 1..219 41..259 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:04:34 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
CG41128-RB 1..219 41..259 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:10 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
CG41128-RA 1..258 2..259 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:30:06 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
CG41128-RB 1..219 41..259 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:33 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
CG41128-RA 2..309 2..309 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:30 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
CG41128-RB 13..321 1..309 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:04:34 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
CG41128-RB 13..321 1..309 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:11 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
CG41128-RA 2..309 2..309 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:30:06 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
CG41128-RB 56..364 1..309 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:50 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
3R 3750418..3750539 1..122 99 -> Plus
3R 3752167..3752353 123..309 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:50 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
3R 3750418..3750539 1..122 99 -> Plus
3R 3752167..3752353 123..309 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:50 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
3R 3750418..3750539 1..122 99 -> Plus
3R 3752167..3752353 123..309 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:04:34 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
3RHet 1806528..1806714 123..309 100 <- Minus
3RHet 1808342..1808462 1..122 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:35 Download gff for RH61753.complete
Subject Subject Range Query Range Percent Splice Strand
3R 3411856..3411977 1..122 99 -> Plus
3R 3413605..3413791 123..309 100   Plus

RH61753.hyp Sequence

Translation from 0 to 258

> RH61753.hyp
NFLSPFNVVLAIKMTSRDNIFEEKICNRLDHCVSDVLIKGCGGVIIGSAV
SFLILKRRAWPVWLGAGFGMGIAYRTCEKDLNSLK*

RH61753.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG41128-PB 72 CG41128-PB 1..72 14..85 385 100 Plus
CG12479-PA 74 CG12479-PA 6..69 22..85 218 54.7 Plus
CG13564-PA 81 CG13564-PA 27..79 30..82 141 45.3 Plus

RH61753.pep Sequence

Translation from 1 to 258

> RH61753.pep
NFLSPFNVVLAIKMTSRDNIFEEKICNRLDHCVSDVLIKGCGGVIIGSAV
SFLILKRRAWPVWLGAGFGMGIAYRTCEKDLNSLK*

RH61753.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19235-PA 74 GF19235-PA 6..69 22..85 219 57.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19471-PA 74 GG19471-PA 6..69 22..85 214 56.2 Plus
Dere\GG22938-PA 81 GG22938-PA 27..80 30..83 130 38.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17826-PA 73 GH17826-PA 7..73 19..85 142 49.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG41128-PB 72 CG41128-PB 1..72 14..85 385 100 Plus
CG12479-PA 74 CG12479-PA 6..69 22..85 218 54.7 Plus
CG13564-PA 81 CG13564-PA 27..79 30..82 141 45.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21742-PA 73 GI21742-PA 8..73 20..85 155 48.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21878-PA 96 GL21878-PA 44..96 32..85 201 68.5 Plus
Dper\GL14995-PA 79 GL14995-PA 14..70 29..85 188 57.9 Plus
Dper\GL11664-PA 86 GL11664-PA 27..81 30..84 148 43.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25618-PA 96 GA25618-PA 44..96 32..85 199 68.5 Plus
Dpse\GA28225-PA 69 GA28225-PA 14..69 30..85 193 55.4 Plus
Dpse\GA22471-PA 79 GA22471-PA 14..70 29..85 188 57.9 Plus
Dpse\GA12365-PA 86 GA12365-PA 27..81 30..84 148 43.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17571-PA 74 GM17571-PA 6..69 22..85 212 54.7 Plus
Dsec\GM18303-PA 81 GM18303-PA 27..80 30..83 140 44.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15861-PA 74 GD15861-PA 6..69 22..85 212 54.7 Plus
Dsim\GD15460-PA 81 GD15460-PA 27..80 30..83 140 44.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19123-PA 73 GJ19123-PA 9..73 21..85 156 49.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18838-PA 75 GK18838-PA 3..75 13..85 216 54.8 Plus
Dwil\GK19385-PA 72 GK19385-PA 13..69 30..83 143 47.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16125-PA 74 GE16125-PA 6..69 22..85 214 56.2 Plus
Dyak\GE14376-PA 81 GE14376-PA 27..80 30..83 130 38.9 Plus