Clone RH62365 Report

Search the DGRC for RH62365

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:623
Well:65
Vector:pFlc-1
Associated Gene/TranscriptCG14022-RA
Protein status:RH62365.pep: gold
Preliminary Size:334
Sequenced Size:660

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14022 2002-01-01 Sim4 clustering to Release 2
CG14022 2002-04-22 Blastp of sequenced clone
CG14022 2003-01-01 Sim4 clustering to Release 3
CG14022 2008-04-29 Release 5.5 accounting
CG14022 2008-08-15 Release 5.9 accounting
CG14022 2008-12-18 5.12 accounting

Clone Sequence Records

RH62365.complete Sequence

660 bp (660 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113613

> RH62365.complete
GCGTTTTAAATTTGCGACGGTTTGTTGAAAATCAAGCTAGCGATCGCGGC
GGAAAAAATCGCTTCGAGTAAAATAATTTTCAAAAAATATATATGCTTAA
TTGGGGATTCAAGTCTGCATAGAATATAAACCAGGTTGCAGGGCTTTTTC
AAGTGCGAGTAAAGTGATAAAATCAGGAAATTCTAAAATAACGACCAGTT
TGCTGCCAAATTTACATAACCAAATCGAAATCGATCGAAATGGGCATTCC
GGATATCCGACTGCTGGTGACGCTGGATTTCGAGGTCTATGGACATGTAC
AAGGCCTGAATCTCACGAAAGACACCCGCGATCGCTGCACCAAGGCGGGA
ATCACTGGCTGGGTGAAGAACAGCAAACAGGGCACCATTGTGGGCAAGAT
GCAGGGGCCCAAGGAGGAGGTGGACAAGATGATCACCTGGCTGTCCACTG
AGGGCTCACCCGGCTGCCAAATCGATCGCTGTGAGGTCCGGAACCAGGGC
AATCTCAGCCGACTGGACTACAAGGACTTTGCCATTAGGTTTTAGATGTG
GTCCGGTTTGTGTGGCCTTATAGTTTTGTGTGTTTGTTTTGTGCATTACT
TGGCTAAGTTTGTAAATACGAGTAAATAATAAAGAATTTAATCACAAAAA
AAAAAAAAAA

RH62365.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14022-RA 651 CG14022-RA 10..651 3..644 3210 100 Plus
cype-RA 618 cype-RA 501..618 644..527 590 100 Minus
cype.a 618 cype.a 531..618 644..557 440 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5327668..5327969 304..3 1510 100 Minus
chr2L 23010047 chr2L 5327075..5327288 644..431 1070 100 Minus
chr2L 23010047 chr2L 5327351..5327480 431..302 650 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5328569..5328870 304..3 1510 100 Minus
2L 23513712 2L 5327976..5328189 644..431 1070 100 Minus
2L 23513712 2L 5328252..5328381 431..302 650 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5328569..5328870 304..3 1510 100 Minus
2L 23513712 2L 5327976..5328189 644..431 1070 100 Minus
2L 23513712 2L 5328252..5328381 431..302 650 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:35:49 has no hits.

RH62365.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:36:28 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5327074..5327288 431..645 99 <- Minus
chr2L 5327352..5327478 304..430 100 <- Minus
chr2L 5327669..5327969 1..303 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:51:31 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
CG14022-RA 1..306 240..545 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:51 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
CG14022-RA 1..306 240..545 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:16:40 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
CG14022-RA 1..306 240..545 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:51:11 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
CG14022-RA 1..306 240..545 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:25:04 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
CG14022-RA 1..306 240..545 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:37:54 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
CG14022-RA 1..640 3..642 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:51 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
CG14022-RA 1..640 3..642 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:16:40 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
CG14022-RA 8..651 1..645 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:51:11 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
CG14022-RA 1..640 3..642 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:25:04 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
CG14022-RA 8..651 1..645 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:36:28 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5327975..5328189 431..645 99 <- Minus
2L 5328253..5328379 304..430 100 <- Minus
2L 5328570..5328870 1..303 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:36:28 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5327975..5328189 431..645 99 <- Minus
2L 5328253..5328379 304..430 100 <- Minus
2L 5328570..5328870 1..303 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:36:28 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5327975..5328189 431..645 99 <- Minus
2L 5328253..5328379 304..430 100 <- Minus
2L 5328570..5328870 1..303 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:16:40 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5327975..5328189 431..645 99 <- Minus
arm_2L 5328253..5328379 304..430 100 <- Minus
arm_2L 5328570..5328870 1..303 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:23:08 Download gff for RH62365.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5327975..5328189 431..645 99 <- Minus
2L 5328253..5328379 304..430 100 <- Minus
2L 5328570..5328870 1..303 99   Minus

RH62365.pep Sequence

Translation from 239 to 544

> RH62365.pep
MGIPDIRLLVTLDFEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTI
VGKMQGPKEEVDKMITWLSTEGSPGCQIDRCEVRNQGNLSRLDYKDFAIR
F*

RH62365.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15515-PA 101 GF15515-PA 1..101 1..101 514 94.1 Plus
Dana\GF18541-PA 102 GF18541-PA 3..101 2..100 181 34.3 Plus
Dana\GF14085-PA 119 GF14085-PA 22..118 4..100 166 34 Plus
Dana\GF12022-PA 108 GF12022-PA 8..100 9..101 166 34.4 Plus
Dana\GF19668-PA 116 GF19668-PA 6..97 9..100 147 29.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24308-PA 101 GG24308-PA 1..101 1..101 531 99 Plus
Dere\GG10375-PA 124 GG10375-PA 32..123 9..100 176 37 Plus
Dere\GG16952-PA 102 GG16952-PA 10..101 9..100 169 32.6 Plus
Dere\GG24762-PA 149 GG24762-PA 56..146 9..99 168 34.1 Plus
Dere\GG20418-PA 107 GG20418-PA 7..99 9..101 167 34.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13536-PA 101 GH13536-PA 1..101 1..101 488 88.1 Plus
Dgri\GH11331-PA 99 GH11331-PA 4..98 6..100 167 31.6 Plus
Dgri\GH15191-PA 141 GH15191-PA 41..135 5..99 167 35.8 Plus
Dgri\GH18239-PA 96 GH18239-PA 4..95 9..100 166 32.6 Plus
Dgri\GH11746-PA 124 GH11746-PA 29..123 6..100 165 31.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14022-PB 101 CG14022-PB 1..101 1..101 540 100 Plus
CG14022-PA 101 CG14022-PA 1..101 1..101 540 100 Plus
Acyp-PB 120 CG16870-PB 10..97 13..100 170 37.5 Plus
Acyp-PA 120 CG16870-PA 10..97 13..100 170 37.5 Plus
CG34161-PC 125 CG34161-PC 33..124 9..100 168 35.9 Plus
CG34161-PA 125 CG34161-PA 33..124 9..100 168 35.9 Plus
CG18371-PA 110 CG18371-PA 13..100 14..101 162 36.4 Plus
CG11052-PD 149 CG11052-PD 61..146 14..99 162 36 Plus
CG11052-PC 149 CG11052-PC 61..146 14..99 162 36 Plus
CG11052-PB 149 CG11052-PB 61..146 14..99 162 36 Plus
CG11052-PA 149 CG11052-PA 61..146 14..99 162 36 Plus
CG34161-PB 120 CG34161-PB 33..119 9..100 146 34.8 Plus
Acyp2-PB 102 CG18505-PB 10..101 9..100 143 27.2 Plus
Acyp2-PA 102 CG18505-PA 10..101 9..100 143 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10542-PA 101 GI10542-PA 1..101 1..101 484 89.1 Plus
Dmoj\GI17837-PA 99 GI17837-PA 12..98 14..100 161 33.3 Plus
Dmoj\GI22288-PA 120 GI22288-PA 6..95 11..100 159 33.3 Plus
Dmoj\GI10195-PA 96 GI10195-PA 4..94 9..99 152 29.7 Plus
Dmoj\GI21180-PA 110 GI21180-PA 8..100 9..101 151 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18556-PA 102 GL18556-PA 4..102 3..101 490 91.9 Plus
Dper\GL22235-PA 102 GL22235-PA 6..101 5..100 171 29.2 Plus
Dper\GL16721-PA 110 GL16721-PA 13..100 14..101 166 36.4 Plus
Dper\GL22340-PA 143 GL22340-PA 47..141 6..100 155 32.6 Plus
Dper\GL26404-PA 132 GL26404-PA 17..116 1..100 154 31 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12705-PA 102 GA12705-PA 4..102 3..101 490 91.9 Plus
Dpse\GA27428-PA 102 GA27428-PA 6..101 5..100 171 29.2 Plus
Dpse\GA14909-PA 110 GA14909-PA 13..100 14..101 166 36.4 Plus
Dpse\GA28850-PA 117 GA28850-PA 17..116 1..100 154 31 Plus
Dpse\GA28779-PA 116 GA28779-PA 6..97 9..100 147 30.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18025-PA 101 GM18025-PA 1..101 1..101 536 100 Plus
Dsec\GM15374-PA 120 GM15374-PA 8..97 11..100 170 36.7 Plus
Dsec\GM21504-PA 110 GM21504-PA 8..100 9..101 167 34.4 Plus
Dsec\GM11586-PA 124 GM11586-PA 36..123 13..100 162 36.4 Plus
Dsec\GM10438-PA 149 GM10438-PA 56..146 9..99 162 33 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acyp-PA 120 GD23938-PA 8..97 11..100 170 36.7 Plus
Dsim\GD10999-PA 110 GD10999-PA 8..100 9..101 167 34.4 Plus
Dsim\GD22242-PA 124 GD22242-PA 37..123 14..100 166 36.8 Plus
Dsim\GD19440-PA 149 GD19440-PA 56..146 9..99 162 33 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21758-PA 101 GJ21758-PA 1..101 1..101 494 90.1 Plus
Dvir\GJ17330-PA 99 GJ17330-PA 12..98 14..100 164 33.3 Plus
Dvir\GJ23483-PA 96 GJ23483-PA 9..95 14..100 159 36.8 Plus
Dvir\GJ21038-PA 111 GJ21038-PA 8..100 9..101 157 33.3 Plus
Dvir\GJ24080-PA 122 GJ24080-PA 6..95 11..100 149 32.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18433-PA 101 GK18433-PA 1..101 1..101 467 83.2 Plus
Dwil\GK12388-PA 99 GK12388-PA 1..98 3..100 198 34.7 Plus
Dwil\GK14028-PA 139 GK14028-PA 40..137 3..100 183 34.7 Plus
Dwil\GK19418-PA 107 GK19418-PA 8..100 9..101 171 34.4 Plus
Dwil\GK15522-PA 126 GK15522-PA 30..125 5..100 159 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19003-PA 101 GE19003-PA 1..101 1..101 536 100 Plus
Dyak\GE13517-PA 124 GE13517-PA 32..123 9..100 173 35.9 Plus
Dyak\GE24338-PA 102 GE24338-PA 10..101 9..100 169 31.5 Plus
Dyak\GE19011-PA 120 GE19011-PA 8..97 11..100 169 36.7 Plus
Dyak\GE12579-PA 110 GE12579-PA 13..100 14..101 168 36.4 Plus

RH62365.hyp Sequence

Translation from 239 to 544

> RH62365.hyp
MGIPDIRLLVTLDFEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTI
VGKMQGPKEEVDKMITWLSTEGSPGCQIDRCEVRNQGNLSRLDYKDFAIR
F*

RH62365.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14022-PB 101 CG14022-PB 1..101 1..101 540 100 Plus
CG14022-PA 101 CG14022-PA 1..101 1..101 540 100 Plus
Acyp-PB 120 CG16870-PB 10..97 13..100 170 37.5 Plus
Acyp-PA 120 CG16870-PA 10..97 13..100 170 37.5 Plus
CG34161-PC 125 CG34161-PC 33..124 9..100 168 35.9 Plus