Clone RH62559 Report

Search the DGRC for RH62559

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:625
Well:59
Vector:pFlc-1
Associated Gene/TranscriptCG8317-RA
Protein status:RH62559.pep: gold
Preliminary Size:693
Sequenced Size:1047

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8317 2002-01-01 Sim4 clustering to Release 2
CG8317 2003-05-20 Blastp of sequenced clone
CG8317 2008-04-29 Release 5.5 accounting
CG8317 2008-08-15 Release 5.9 accounting
CG8317 2008-12-18 5.12 accounting

Clone Sequence Records

RH62559.complete Sequence

1047 bp (1047 high quality bases) assembled on 2003-05-20

GenBank Submission: BT011014

> RH62559.complete
GACAGTCGAAGCGCACGCTCAGCGGCGACAGCAACGAGAATCGAAGCCAA
CCAAAGCGAATCGATAGCCCCGGGGGCCAACAAGGTGTTAAGCGATCACT
GATAACAAACAAACTGACTAACTAATCGATCGATCAGAACGGTTTCGACT
ATTCGCGAGTGAAATCTTCAATCTACAATCTGCAATCTGCAATCTACAAT
CTTTCATCCGAATTGGAAAAAGTGACTAAGTGCAGACTCGAAACAGGATA
CTCCACTCAACGCAACTCGACTAACGCATACCCAGCAAAGATGTTTGCGT
ACACTTGGCAACTCGCTCCACTGATCCTGGTCATTCTGGCGACAACGATG
ACGACGACAATGGCTGCACCGCAGCAGCAGGAGGTGCCCCACGCCCTGCT
GGACATCGAGACGCCCAATCAGTTCAACTACAGTCCCTCGCCGTTGGCAC
AGCCGGATAGTCTGCGATCCAAGCCGTACTTTGATTTTCTGAGCACACTG
TATGCCCACGATACGGCCAAGTCGAATCTGTTTCGGCCATATTCGGTGCG
CCAGCGCAGGGATGCGGATGTCCAGAAGCTGAGTCGTCCGCGACGGGCCA
TCGTCTTTCGGCCGCTGTTCGTGTACAAGCAGCAGGAGATTCGGAAGCAG
GAGATCAGGGACAGGAATGCCCAGAGGCGTCACGATCTGAACCGTCTGCA
GCGGGTGTAGTACACTCCAATCGAATCCAGTGTCCATCCAGCCAATCCGG
TTTGGTTTGGCCTTCTACAGGGTCCTCTAGCACTTAGCCACTTAGCCACT
TTCGATGCGTCCTAGTTCTAAGTCAAATGCACTGAGCACGAATATAGAGA
AAGAGAATGGAGCACTCATCATATTAAATATTATATAATATATATATATA
TATACACATTCGCACCAAACACCCACAATCACAACCACAAACACATCCTC
GTAGATTAAGGCCCAAATGTTTGTTATGCCACTTGTTATCGCGACGTTTG
ATTAAAGCTAACAAAACTGATATCAAAATACAAAAAAAAAAAAAAAA

RH62559.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG8317-RA 1268 CG8317-RA 150..1184 2..1035 5120 99.8 Plus
CG8317.a 1799 CG8317.a 681..1715 2..1035 5120 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12461822..12462554 1029..308 3325 97.5 Minus
chr2R 21145070 chr2R 12463519..12463828 311..2 1490 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16574575..16575303 1035..308 3565 99.6 Minus
2R 25286936 2R 16576273..16576582 311..2 1550 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16575774..16576502 1035..308 3575 99.5 Minus
2R 25260384 2R 16577472..16577781 311..2 1550 100 Minus
Blast to na_te.dros performed 2019-03-16 23:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
G-element 4346 G-element DMREPG 4346bp Derived from X06950 (g8427) (Rel. 16, Last updated, Version 1). 554..617 313..379 110 70.6 Plus

RH62559.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:48:16 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12461820..12462550 312..1031 97 <- Minus
chr2R 12463519..12463828 1..311 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:51:33 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
CG8317-RA 1..420 291..710 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:36:55 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
CG8317-RA 1..420 291..710 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:24:53 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
CG8317-RA 1..420 291..710 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:12:56 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
CG8317-RA 1..420 291..710 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:59:53 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
CG8317-RA 1..420 291..710 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:40:24 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
CG8317-RA 1..1031 2..1031 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:36:55 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
CG8317-RA 1..1031 2..1031 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:24:53 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
CG8317-RA 3..1035 1..1031 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:12:56 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
CG8317-RA 1..1031 2..1031 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:59:53 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
CG8317-RA 3..1035 1..1031 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:48:16 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16574579..16575299 312..1031 99 <- Minus
2R 16576273..16576582 1..311 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:48:16 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16574579..16575299 312..1031 99 <- Minus
2R 16576273..16576582 1..311 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:48:16 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16574579..16575299 312..1031 99 <- Minus
2R 16576273..16576582 1..311 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:24:53 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12462084..12462804 312..1031 99 <- Minus
arm_2R 12463778..12464087 1..311 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:49:26 Download gff for RH62559.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16575778..16576498 312..1031 99 <- Minus
2R 16577472..16577781 1..311 99   Minus

RH62559.hyp Sequence

Translation from 290 to 709

> RH62559.hyp
MFAYTWQLAPLILVILATTMTTTMAAPQQQEVPHALLDIETPNQFNYSPS
PLAQPDSLRSKPYFDFLSTLYAHDTAKSNLFRPYSVRQRRDADVQKLSRP
RRAIVFRPLFVYKQQEIRKQEIRDRNAQRRHDLNRLQRV*

RH62559.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG8317-PA 139 CG8317-PA 1..139 1..139 716 100 Plus
CG8317-PB 152 CG8317-PB 1..152 1..139 692 91.4 Plus
CG8317-PC 120 CG8317-PC 1..120 20..139 620 100 Plus

RH62559.pep Sequence

Translation from 290 to 709

> RH62559.pep
MFAYTWQLAPLILVILATTMTTTMAAPQQQEVPHALLDIETPNQFNYSPS
PLAQPDSLRSKPYFDFLSTLYAHDTAKSNLFRPYSVRQRRDADVQKLSRP
RRAIVFRPLFVYKQQEIRKQEIRDRNAQRRHDLNRLQRV*

RH62559.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13463-PA 137 GF13463-PA 1..137 1..139 539 77.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22260-PA 140 GG22260-PA 1..140 1..139 623 92.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20709-PA 171 GH20709-PA 51..157 31..122 304 62 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
Lst-PA 139 CG8317-PA 1..139 1..139 716 100 Plus
Lst-PB 152 CG8317-PB 1..152 1..139 692 91.4 Plus
Lst-PC 120 CG8317-PC 1..120 20..139 620 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19070-PA 118 GI19070-PA 5..118 27..139 323 65.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17215-PA 146 GL17215-PA 1..139 1..132 495 72.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25045-PA 146 GA25045-PA 1..139 1..132 496 72.9 Plus
Dpse\GA25045-PC 149 GA25045-PC 5..142 3..132 469 69.6 Plus
Dpse\GA25045-PB 130 GA25045-PB 3..123 20..132 450 76 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20050-PA 139 GM20050-PA 2..139 1..139 698 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25531-PA 139 GD25531-PA 2..139 1..139 654 92.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20043-PA 123 GJ20043-PA 5..109 27..132 315 66.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20896-PA 145 GK20896-PA 1..134 1..132 448 68.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14053-PA 139 GE14053-PA 1..139 1..139 613 87.3 Plus