Clone RH62928 Report

Search the DGRC for RH62928

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:629
Well:28
Vector:pFlc-1
Associated Gene/TranscriptCG6429-RA
Protein status:RH62928.pep: gold
Preliminary Size:375
Sequenced Size:687

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6429 2001-12-17 Blastp of sequenced clone
CG6429 2002-01-01 Sim4 clustering to Release 2
CG6429 2003-01-01 Sim4 clustering to Release 3
CG6429 2008-04-29 Release 5.5 accounting
CG6429 2008-08-15 Release 5.9 accounting
CG6429 2008-12-18 5.12 accounting

Clone Sequence Records

RH62928.complete Sequence

687 bp (687 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071758

> RH62928.complete
GTCAGTGGCTGAACAATCGCGAAAGGCATCGAATCGGAAGTGAATACACA
TCTCGAGCTATGCATAGTGCACATATATTATTTTTCGTACTCGGGCTCAC
ATTCGTTGGCATTTGGGTTCAAGCCGAGGTCCAAAAACCCATCACGGAAC
AATGCCTGATCTGTATGTGTGAGGCTTTGAGTGGCTGCAACGCGACGGCT
GTGTGCGTGAATGGGGCATGTGGCATTTTCAGGATCACTTGGGATCAGTG
GGTGGACTCAGGCAGATTGACCATACCTGGCGACTCGCCATTGACGGATA
GTTCTTTTACCAACTGCGCCAATGATCCGTATTGTGCGGCCGATACTTTG
CAGAGTTATATGGTGAAGTACGGACAGGATTGCAACGATGATCAGAAGGA
GGACTGTTACGATTATGGTGCCATTCACTATATGGGTCCCTTCAACTGCA
AGGCGGATATGCCCTACACCTACGAGAGCATTTTCAAACGATGTTTGAGG
AACGCGATGCGGAATGACAAGCGTCAGAATTCCAGCTAGGCCTAATGCAA
CTTTTTCTAGTATTTAGCAACTAACTTATGAGGAAGAGTCCGTTTAATTT
ATGTGCAAATAACTCATAGCTAATATAGGCGTTAATTTCGATTAATAAAC
TAGTGGCTTGGAGTCAACTGAAAAAAAAAAAAAAAAA

RH62928.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG6429-RA 676 CG6429-RA 2..671 2..671 3350 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12760555..12760921 304..670 1790 99.2 Plus
chr2R 21145070 chr2R 12760184..12760485 2..303 1450 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:36:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16873389..16873756 304..671 1840 100 Plus
2R 25286936 2R 16873018..16873319 2..303 1510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16874588..16874955 304..671 1840 100 Plus
2R 25260384 2R 16874217..16874518 2..303 1510 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:40:50 has no hits.

RH62928.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:41:38 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12760183..12760485 1..303 98 -> Plus
chr2R 12760555..12760921 304..670 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:51:38 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
CG6429-RA 1..480 60..539 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:01 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
CG6429-RA 1..480 60..539 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:10:20 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
CG6429-RA 1..480 60..539 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:45 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
CG6429-RA 1..480 60..539 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:41:20 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
CG6429-RA 1..480 60..539 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:22:52 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
CG6429-RA 1..670 2..670 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:01 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
CG6429-RA 1..670 2..670 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:10:20 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
CG6429-RA 3..672 1..670 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:45 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
CG6429-RA 1..670 2..670 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:41:20 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
CG6429-RA 3..672 1..670 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:38 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16873017..16873319 1..303 99 -> Plus
2R 16873389..16873755 304..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:38 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16873017..16873319 1..303 99 -> Plus
2R 16873389..16873755 304..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:38 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16873017..16873319 1..303 99 -> Plus
2R 16873389..16873755 304..670 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:10:20 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12760522..12760824 1..303 99 -> Plus
arm_2R 12760894..12761260 304..670 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:57:45 Download gff for RH62928.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16874216..16874518 1..303 99 -> Plus
2R 16874588..16874954 304..670 100   Plus

RH62928.hyp Sequence

Translation from 2 to 538

> RH62928.hyp
QWLNNRERHRIGSEYTSRAMHSAHILFFVLGLTFVGIWVQAEVQKPITEQ
CLICMCEALSGCNATAVCVNGACGIFRITWDQWVDSGRLTIPGDSPLTDS
SFTNCANDPYCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCK
ADMPYTYESIFKRCLRNAMRNDKRQNSS*

RH62928.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG6429-PA 159 CG6429-PA 1..159 20..178 889 100 Plus
CG6435-PA 163 CG6435-PA 19..148 42..170 465 56.9 Plus
CG6421-PA 161 CG6421-PA 27..152 43..165 454 57.1 Plus
CG6426-PA 161 CG6426-PA 24..160 39..176 425 49.3 Plus

RH62928.pep Sequence

Translation from 59 to 538

> RH62928.pep
MHSAHILFFVLGLTFVGIWVQAEVQKPITEQCLICMCEALSGCNATAVCV
NGACGIFRITWDQWVDSGRLTIPGDSPLTDSSFTNCANDPYCAADTLQSY
MVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKADMPYTYESIFKRCLRNAM
RNDKRQNSS*

RH62928.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11419-PA 158 GF11419-PA 2..157 5..159 616 70.5 Plus
Dana\GF11420-PA 166 GF11420-PA 1..151 8..151 453 49.7 Plus
Dana\GF11418-PA 161 GF11418-PA 7..148 5..142 419 54.9 Plus
Dana\GF11417-PA 161 GF11417-PA 15..158 10..155 394 49.3 Plus
Dana\GF25005-PA 264 GF25005-PA 140..260 26..148 155 30.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20641-PA 159 GG20641-PA 1..159 1..159 817 93.1 Plus
Dere\GG20642-PA 163 GG20642-PA 19..148 23..151 450 57.7 Plus
Dere\GG20639-PA 161 GG20639-PA 8..153 8..147 439 53.4 Plus
Dere\GG20638-PA 161 GG20638-PA 15..158 10..155 401 48.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22646-PA 117 GH22646-PA 1..116 36..151 532 79.3 Plus
Dgri\GH22647-PA 157 GH22647-PA 19..154 24..159 458 57.4 Plus
Dgri\GH22645-PA 163 GH22645-PA 27..154 24..148 419 55.5 Plus
Dgri\GH22644-PA 161 GH22644-PA 15..149 10..146 417 54 Plus
Dgri\GH15386-PA 226 GH15386-PA 101..221 20..147 138 29.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG6429-PA 159 CG6429-PA 1..159 1..159 889 100 Plus
CG6435-PA 163 CG6435-PA 19..148 23..151 465 56.9 Plus
CG6421-PA 161 CG6421-PA 27..152 24..146 454 57.1 Plus
CG6426-PA 161 CG6426-PA 24..160 20..157 425 49.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21158-PA 158 GI21158-PA 10..152 7..151 591 72.4 Plus
Dmoj\GI21157-PA 190 GI21157-PA 48..183 24..156 420 52.2 Plus
Dmoj\GI21159-PA 145 GI21159-PA 12..134 25..151 402 56.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11566-PA 156 GL11566-PA 9..143 6..146 628 80.9 Plus
Dper\GL11565-PA 161 GL11565-PA 7..154 5..148 430 51.4 Plus
Dper\GL11564-PA 161 GL11564-PA 15..158 8..155 397 48 Plus
Dper\GL11567-PA 132 GL11567-PA 1..112 40..151 369 53.6 Plus
Dper\GL25021-PA 254 GL25021-PA 135..235 32..135 156 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19586-PA 156 GA19586-PA 9..143 6..146 625 80.1 Plus
Dpse\GA19580-PA 161 GA19580-PA 7..154 5..148 430 51.4 Plus
Dpse\GA19584-PA 161 GA19584-PA 15..158 8..155 397 48 Plus
Dpse\GA19591-PA 132 GA19591-PA 1..112 40..151 384 56.2 Plus
Dpse\GA13274-PA 254 GA13274-PA 135..235 32..135 152 34.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21734-PA 159 GM21734-PA 1..159 1..159 823 94.3 Plus
Dsec\GM21736-PA 163 GM21736-PA 19..148 23..151 453 56.9 Plus
Dsec\GM21731-PA 161 GM21731-PA 15..160 10..157 400 48 Plus
Dsec\GM21732-PA 91 GM21732-PA 27..83 24..77 199 61.4 Plus
Dsec\GM14814-PA 263 GM14814-PA 137..258 31..151 164 33.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11229-PA 159 GD11229-PA 1..159 1..159 821 95 Plus
Dsim\GD11230-PA 163 GD11230-PA 19..148 23..151 453 56.9 Plus
Dsim\GD11227-PA 161 GD11227-PA 27..154 24..148 430 56.2 Plus
Dsim\GD13989-PA 263 GD13989-PA 137..258 31..151 166 33.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21011-PA 162 GJ21011-PA 16..150 16..149 648 85.2 Plus
Dvir\GJ21012-PA 154 GJ21012-PA 16..147 24..155 451 59.1 Plus
Dvir\GJ21010-PA 161 GJ21010-PA 27..154 24..148 428 58.6 Plus
Dvir\GJ21009-PA 161 GJ21009-PA 15..158 10..155 412 50.7 Plus
Dvir\GJ21008-PA 161 GJ21008-PA 14..158 7..155 377 47 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22027-PA 163 GK22027-PA 30..161 26..157 609 81.8 Plus
Dwil\GK22028-PA 172 GK22028-PA 15..165 5..156 440 49.3 Plus
Dwil\GK22026-PA 166 GK22026-PA 9..155 8..148 437 51.7 Plus
Dwil\GK22025-PA 161 GK22025-PA 15..161 10..158 402 48.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11829-PA 159 GE11829-PA 1..159 1..159 822 93.1 Plus
Dyak\GE11830-PA 164 GE11830-PA 19..148 23..151 453 56.9 Plus
Dyak\GE11828-PA 159 GE11828-PA 8..152 8..148 436 53.8 Plus
Dyak\GE11827-PA 161 GE11827-PA 15..160 10..157 400 48 Plus
Dyak\GE21589-PA 262 GE21589-PA 134..257 29..151 158 31.8 Plus