Clone RH63285 Report

Search the DGRC for RH63285

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:632
Well:85
Vector:pFlc-1
Associated Gene/TranscriptP5cr-RA
Protein status:RH63285.pep: gold
Preliminary Size:1183
Sequenced Size:1150

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6009 2002-01-01 Sim4 clustering to Release 2
CG6009 2003-01-01 Sim4 clustering to Release 3
CG6009 2003-08-11 Blastp of sequenced clone
P5cr 2008-04-29 Release 5.5 accounting
P5cr 2008-08-15 Release 5.9 accounting
P5cr 2008-12-18 5.12 accounting

Clone Sequence Records

RH63285.complete Sequence

1150 bp (1150 high quality bases) assembled on 2003-08-11

GenBank Submission: BT011084

> RH63285.complete
GATGCAATCGGCAGCTGTTATTGATTAGAGGAGCGATAAAAGTCCAGCCA
CCTCAAATATTGACACTAGGACAAGCTCGAGGGCCATTAAGTTATCTAAC
ATCAATCAATTGCTCAAAATCATCTGGTAGGCCTGTTACTATAGCGGGCA
AAGACGTCTCTAAAACCTCAAAGAGTTCCTTAAGCATGGCCAAGTTGGAC
GAAAAGATCGGCTTCATCGGGGGCGGAAACATGGCCTACGCCATAGGATC
CGGACTGGTGCGCTGTGGGATCGTGAAGGCTAGCCAGGTGCAGGTCTCCG
GTCCCCACATTGAGAACCTGCAACGGTGGCGGGATCTGGGAGCTGTGACC
TGCGACGACAACTGCATGGTCCTGGAGCACTCGGACATAGTTTTCATCTG
CGTAAAGCCACACATGCTAACGCCGTGTGCCGCCCAGCTTAAATACAAGC
ACGTGCCGTCGGCCAAGGATGCCAGCAAGCTGGTGGTGTCGGTTCTGGCG
GGTACCAGTCTCGAAACGCTGGAGGAGGCCTTCAGCTTCATGGGCAGTTC
GGAGCTGAAGGTGATACGCACCATGCCCAATACATCCATGCAGGTGGGCG
AGGGCTGCACTGTTTACACTGGCAACGCACGCGTTTCGCATCACGACTTG
GAAAAGATTCACCTAATGCTCAACGCCCTGGGACTGGCGCAACAGGTGCC
CGAGTCCATGATCGACGCCGTTACCGGGGTAGCTGGATGCGGTCCGGCAT
TTGTTTACACCATCATAGAGGCACTGGCCGATGGCGGCGTCAAACAGGGC
GTTCCGCGTCAGATGGCTCTTCAGTTTGCGGCTCAGACGCTTCTGGGAGC
GGCCAAAACGGTGCTGCTCACTGGAAAACATCCGGCGGTGCTGCGGGATG
AAGTCTGTTCTCCCGGTGGCGCCACCATAGTAGGCGTTCATGAACTGGAA
AAGGGGAACCTCAGGTCTACTTTAATAAACGCCGTGGAAAAGTCGTCACA
GCGCTCTGCTGAACTGGGAAAGAAGTGAAAATGTAATCCCCCGGAACATC
CCCTTGCTCTCTACACATACATATAGTTAAACGCTTGATATTGTTATTAC
AATAATGACTAACATAAAAAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAA

RH63285.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
P5cr-RA 1227 P5cr-RA 81..1197 2..1118 5585 100 Plus
P5cr.a 1125 P5cr.a 173..1107 184..1118 4675 100 Plus
Prp18-RA 1284 Prp18-RA 1090..1247 1118..961 790 100 Minus
P5cr.a 1125 P5cr.a 49..173 2..126 625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:36:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14852968..14853932 2..966 4720 99.3 Plus
chr3R 27901430 chr3R 14853988..14854145 961..1118 775 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:36:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19028985..19029949 2..966 4825 100 Plus
3R 32079331 3R 19030005..19030162 961..1118 790 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18769816..18770780 2..966 4825 100 Plus
3R 31820162 3R 18770836..18770993 961..1118 790 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:36:22 has no hits.

RH63285.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:37:34 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14852967..14853930 1..964 99 -> Plus
chr3R 14853992..14854142 965..1115 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:51:48 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-RA 1..843 186..1028 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:48:22 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-RA 1..843 186..1028 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:36:46 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-RA 1..843 186..1028 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:15:49 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-RA 1..843 186..1028 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:28 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-RA 1..843 186..1028 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:12:24 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-RA 48..1162 1..1115 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:48:22 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-RA 48..1162 1..1115 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:36:46 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-RA 48..1162 1..1115 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:15:49 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-RA 48..1162 1..1115 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:28 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
P5cr-RA 54..1168 1..1115 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:37:34 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19028984..19029947 1..964 99 -> Plus
3R 19030009..19030159 965..1115 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:37:34 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19028984..19029947 1..964 99 -> Plus
3R 19030009..19030159 965..1115 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:37:34 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19028984..19029947 1..964 99 -> Plus
3R 19030009..19030159 965..1115 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:36:46 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14854706..14855669 1..964 99 -> Plus
arm_3R 14855731..14855881 965..1115 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:49:42 Download gff for RH63285.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18769815..18770778 1..964 99 -> Plus
3R 18770840..18770990 965..1115 100   Plus

RH63285.hyp Sequence

Translation from 2 to 1027

> RH63285.hyp
CNRQLLLIRGAIKVQPPQILTLGQARGPLSYLTSINCSKSSGRPVTIAGK
DVSKTSKSSLSMAKLDEKIGFIGGGNMAYAIGSGLVRCGIVKASQVQVSG
PHIENLQRWRDLGAVTCDDNCMVLEHSDIVFICVKPHMLTPCAAQLKYKH
VPSAKDASKLVVSVLAGTSLETLEEAFSFMGSSELKVIRTMPNTSMQVGE
GCTVYTGNARVSHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAF
VYTIIEALADGGVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDE
VCSPGGATIVGVHELEKGNLRSTLINAVEKSSQRSAELGKK*

RH63285.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
P5cr-PA 280 CG6009-PA 1..280 62..341 1428 100 Plus
P5cr-2-PA 273 CG5840-PA 6..271 68..341 454 35.9 Plus
P5cr-2-PD 252 CG5840-PD 24..250 105..341 393 35.4 Plus
P5cr-2-PC 252 CG5840-PC 24..250 105..341 393 35.4 Plus
P5cr-2-PB 174 CG5840-PB 2..172 167..341 322 37.7 Plus

RH63285.pep Sequence

Translation from 185 to 1027

> RH63285.pep
MAKLDEKIGFIGGGNMAYAIGSGLVRCGIVKASQVQVSGPHIENLQRWRD
LGAVTCDDNCMVLEHSDIVFICVKPHMLTPCAAQLKYKHVPSAKDASKLV
VSVLAGTSLETLEEAFSFMGSSELKVIRTMPNTSMQVGEGCTVYTGNARV
SHHDLEKIHLMLNALGLAQQVPESMIDAVTGVAGCGPAFVYTIIEALADG
GVKQGVPRQMALQFAAQTLLGAAKTVLLTGKHPAVLRDEVCSPGGATIVG
VHELEKGNLRSTLINAVEKSSQRSAELGKK*

RH63285.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18595-PA 280 GF18595-PA 1..280 1..280 1345 89.6 Plus
Dana\GF16410-PA 273 GF16410-PA 6..271 7..280 466 37.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23118-PA 280 GG23118-PA 1..280 1..280 1354 90.7 Plus
Dere\GG22275-PA 273 GG22275-PA 6..271 7..280 456 36.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18149-PA 280 GH18149-PA 1..280 1..280 1267 84.3 Plus
Dgri\GH13554-PA 273 GH13554-PA 6..268 7..277 482 38.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
P5cr-PA 280 CG6009-PA 1..280 1..280 1428 100 Plus
P5cr-2-PA 273 CG5840-PA 6..271 7..280 454 35.9 Plus
P5cr-2-PD 252 CG5840-PD 24..250 44..280 393 35.4 Plus
P5cr-2-PC 252 CG5840-PC 24..250 44..280 393 35.4 Plus
P5cr-2-PB 174 CG5840-PB 2..172 106..280 322 37.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23448-PA 280 GI23448-PA 1..280 1..280 1281 84.6 Plus
Dmoj\GI24792-PA 273 GI24792-PA 6..271 7..280 450 37.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13575-PA 280 GL13575-PA 1..280 1..280 1311 87.1 Plus
Dper\GL23580-PA 258 GL23580-PA 1..258 16..280 418 36.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19292-PA 280 GA19292-PA 1..280 1..280 1311 87.1 Plus
Dpse\GA19170-PA 272 GA19170-PA 6..268 7..277 474 38.5 Plus
Dpse\GA28081-PA 180 GA28081-PA 7..95 60..148 385 80.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23296-PA 280 GM23296-PA 1..280 1..280 1453 97.5 Plus
Dsec\GM15240-PA 273 GM15240-PA 6..271 7..280 456 35.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19166-PA 273 GD19166-PA 6..271 7..280 451 35.4 Plus
Dsim\GD19267-PA 71 GD19267-PA 1..71 210..280 358 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23775-PA 280 GJ23775-PA 1..280 1..280 1301 86.4 Plus
Dvir\GJ24440-PA 273 GJ24440-PA 6..251 7..260 453 39.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13573-PA 280 GK13573-PA 1..280 1..280 1342 89.6 Plus
Dwil\GK11036-PA 272 GK11036-PA 6..269 7..277 445 38 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25577-PA 280 GE25577-PA 1..280 1..280 1426 96.1 Plus
Dyak\GE25476-PA 273 GE25476-PA 6..271 7..280 458 36.1 Plus