Clone RH63449 Report

Search the DGRC for RH63449

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:634
Well:49
Vector:pFlc-1
Associated Gene/TranscriptCG13108-RA
Protein status:RH63449.pep: gold
Preliminary Size:702
Sequenced Size:1037

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13108 2002-01-01 Sim4 clustering to Release 2
CG13108 2002-03-28 Blastp of sequenced clone
CG13108 2003-01-01 Sim4 clustering to Release 3
CG13108 2008-04-29 Release 5.5 accounting
CG13108 2008-08-15 Release 5.9 accounting
CG13108 2008-12-18 5.12 accounting

Clone Sequence Records

RH63449.complete Sequence

1037 bp (1037 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094947

> RH63449.complete
GAGCTTTGAGACGCAGCAGCCACAGCAGCAGCAAAAGCAGCAGCAGCAGC
CGCTGCAGGATTTAGCGGTCGGTTCAACCAGGAGCAGCAGGAGTAGAGAA
TTTTCGCGTCAGAATGCGAAGTCGCACGGAACTGGTGACCACCACTTTCG
AGGAGAGCGACGAGGATGATTTCAGTCCGGACGATTCCGACTCCGAGGAG
GACTGGCGACCCACCAAGAAACGTCCGTCCAAGCCATCTGGCTCCGATGG
CGGCAGGAAGCGGAAATCGGCGGCAGCCAATGCCTCGAAGGCCAAGCGCC
GGATGGCCAAGGTGAGCGACGAGGAGTCCGACGAAGAGGATGACCTAGAA
ACCGATCCCAGCGACGACGACTTTGACTACCCGTCGGCCAGCACTTCAAA
GCGACCCCAGAGTCTGCCGCCCAAGAAGCAATTTGTTAAGTTAAGCCAAC
TGGATTTGCTGGTAAAAAAGTCTGATCTTATGGAAAACGACTGGCTAAAG
AACAATCGCTTGTGTCTGTGGCGCAAAGATGAACAAACGAATCTGCTTCA
GAAGTATCTGCGGGTCAAGTCGGCTGCCGAGGAGGAGGAGCTGCTCTTTA
CCTCCAGTTCTGTATATTCCAGTTGGGATGATCAGCAGACGAGCGACTTC
ATAGAGGTCAAAGTCAACTGCTTGGATCCCAACAACAGACGTATTAAACT
GCACGATCTGGAGGCGATTAAGAAAATCTCCGTGGAACTACAATCAGAGC
GAAATAAGAAAACGACATCGGACAAAGAAGATACTTTGGAGGCGGAGGAG
GATAAGCAAAATTAAGCTGATTCTTAAAAAAAAAACAACTACTAATTATA
CACAAAACTAACATTTTCATTAGTATTTACAACTAGTTGGCCAAGTTAGG
GTTAAACAACAAATTTCCTTGTAACAGCTATGTGAAAACAGCATTAAATT
TAATTTAGAAAATTAAAGAAACTAAGAAAAAAAAAGGAAATCAAAAGGAA
AACATTTGAAAATATCAAACTAAAAAAAAAAAAAAAA

RH63449.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG13108-RA 1099 CG13108-RA 80..1097 2..1019 5090 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9163147..9163759 2..614 2930 98.5 Plus
chr2L 23010047 chr2L 9163931..9164332 615..1019 1805 97.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:36:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9164236..9164848 2..614 3065 100 Plus
2L 23513712 2L 9165020..9165430 615..1025 2040 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9164236..9164848 2..614 3065 100 Plus
2L 23513712 2L 9165020..9165430 615..1025 2040 99.7 Plus
Blast to na_te.dros performed on 2019-03-15 20:38:20 has no hits.

RH63449.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:39:29 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9163209..9163759 64..614 98 -> Plus
chr2L 9163931..9164333 615..1021 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:51:53 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
CG13108-RA 1..702 114..815 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:22:25 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
CG13108-RA 1..702 114..815 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:16:46 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
CG13108-RA 1..702 114..815 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:08 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
CG13108-RA 1..702 114..815 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:25:11 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
CG13108-RA 1..702 114..815 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:49:23 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
CG13108-RA 2..1020 2..1021 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:22:25 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
CG13108-RA 2..1020 2..1021 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:16:46 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
CG13108-RA 2..1020 2..1021 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:08 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
CG13108-RA 2..1020 2..1021 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:25:11 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
CG13108-RA 2..1020 2..1021 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:29 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9164235..9164848 1..614 99 -> Plus
2L 9165020..9165425 615..1021 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:29 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9164235..9164848 1..614 99 -> Plus
2L 9165020..9165425 615..1021 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:29 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9164235..9164848 1..614 99 -> Plus
2L 9165020..9165425 615..1021 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:16:46 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9164235..9164848 1..614 99 -> Plus
arm_2L 9165020..9165425 615..1021 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:31:52 Download gff for RH63449.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9164235..9164848 1..614 99 -> Plus
2L 9165020..9165425 615..1021 99   Plus

RH63449.hyp Sequence

Translation from 113 to 814

> RH63449.hyp
MRSRTELVTTTFEESDEDDFSPDDSDSEEDWRPTKKRPSKPSGSDGGRKR
KSAAANASKAKRRMAKVSDEESDEEDDLETDPSDDDFDYPSASTSKRPQS
LPPKKQFVKLSQLDLLVKKSDLMENDWLKNNRLCLWRKDEQTNLLQKYLR
VKSAAEEEELLFTSSSVYSSWDDQQTSDFIEVKVNCLDPNNRRIKLHDLE
AIKKISVELQSERNKKTTSDKEDTLEAEEDKQN*

RH63449.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13108-PA 233 CG13108-PA 1..233 1..233 1200 100 Plus

RH63449.pep Sequence

Translation from 113 to 814

> RH63449.pep
MRSRTELVTTTFEESDEDDFSPDDSDSEEDWRPTKKRPSKPSGSDGGRKR
KSAAANASKAKRRMAKVSDEESDEEDDLETDPSDDDFDYPSASTSKRPQS
LPPKKQFVKLSQLDLLVKKSDLMENDWLKNNRLCLWRKDEQTNLLQKYLR
VKSAAEEEELLFTSSSVYSSWDDQQTSDFIEVKVNCLDPNNRRIKLHDLE
AIKKISVELQSERNKKTTSDKEDTLEAEEDKQN*

RH63449.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22711-PA 246 GF22711-PA 1..228 1..219 742 73.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25334-PA 248 GG25334-PA 1..225 1..223 959 91.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13269-PA 272 GH13269-PA 1..264 1..231 576 55.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13108-PA 233 CG13108-PA 1..233 1..233 1200 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17465-PA 330 GI17465-PA 1..248 1..210 570 57.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26247-PA 287 GL26247-PA 1..220 1..215 666 65.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12049-PA 287 GA12049-PA 1..220 1..215 658 65.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17413-PA 237 GM17413-PA 1..233 1..233 1151 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23590-PA 247 GD23590-PA 1..224 1..224 1128 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14451-PA 282 GJ14451-PA 1..243 1..212 625 63 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15069-PA 284 GK15069-PA 1..247 1..230 740 67.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18828-PA 237 GE18828-PA 1..233 1..233 1046 93.1 Plus