Clone RH64960 Report

Search the DGRC for RH64960

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:649
Well:60
Vector:pFlc-1
Associated Gene/TranscriptCG12818-RA
Protein status:RH64960.pep: gold
Sequenced Size:1019

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12818 2008-04-29 Release 5.5 accounting
CG12818 2008-04-29 Picked prior to 5.5
CG12818 2008-08-15 Release 5.9 accounting
CG12818 2008-12-18 5.12 accounting

Clone Sequence Records

RH64960.complete Sequence

1019 bp assembled on 2007-09-25

GenBank Submission: BT031026

> RH64960.complete
GAATCGATTACAGGAATGTCAACAAAGTGGAAATAAAATGAATATTTTAC
CAAAAAAACGCTGGCATGTGCGTACCAAGGAGAACATTGCCCGCGTGCGC
CGGGATCAAGCGGCTGCCGCAGCAGAAGAAAAAGTCCGGCAGGAGAAATT
GGAATTTGCTGAAAGCGAGGCACGAATCAACTTCCTGCGCCGCCAATCGG
GCTTGCCGGAGAAGGCCTCCAAGGAATCTCGAGAGGAGTCGCAATGCAGT
ACTGAAACAACCAAAGGGGTGGATCTCTTTGCCGACTACAAGGCGAGAGT
GAAGACCACTAACAAAGACTTGGAAAAGGAGCAAAAGGAGGAGCAGGAGA
AGTATGAGAAGCAGATCGGCTACCTCACCTACTTGGGCCAGGACACCAAT
GAAGCTTTGAAAGTGCGCAGCTGGTACGAGTTAGCCCCCAAAAGACCAGA
AGTTGGGGATCCCACAGCTACTGAAACTCATCATAAGCAAAAGCTAGCCC
ACGATCCTCTGACCCTAATTAATGCTTTGTTGCCGCCAGAAAAAAAGGAT
CCCAAAAAGGCCACAAAAAGAATTCGCGAAAGGACACCCGCGCCTTCTCA
GGAACCTTCAATACCCCACAAGGACAAGAAATCCAAGAAAGATAAGAAGA
AGCACAAGAGCAAAAATGGTTCAAGGGAGACCCTTTTGGCCGAGGAACGC
ATAAAACGAGAAAAGCTCGAGACGCTAAGAAGGGAGCGCATGCGACGGGA
AACAGCGGAACGCCAGCGTTCCGAGGCTCTGTTCGCACCCAAGGAGCTGC
CGGTGGCTGCCAGTGCCGAATCCACGCCGGCTTCGACGCCTAAGGTTGTC
CAAAAGTACAACAGTCAGTTTAATCCGGAGTTAGCAAAGCAAAATATGCT
CTAGCCATTAATTATGTTTTCAACTTAATGTTAACAGCCTGATTATGAAT
ATAATCACTAAGCAAATAAATAGAAATTACACTTTATTATTGAATTGTTT
AAAAAAAAAAAAAAAAAAA

RH64960.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG12818-RA 1144 CG12818-RA 107..1112 2..1007 5015 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6157603..6158440 161..998 4175 99.9 Plus
chr3R 27901430 chr3R 6157444..6157545 60..161 510 100 Plus
chr3R 27901430 chr3R 6157330..6157388 2..60 295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:36:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10331856..10332702 161..1007 4220 99.9 Plus
3R 32079331 3R 10331697..10331798 60..161 510 100 Plus
3R 32079331 3R 10331583..10331641 2..60 295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10072687..10073533 161..1007 4220 99.8 Plus
3R 31820162 3R 10072528..10072629 60..161 510 100 Plus
3R 31820162 3R 10072414..10072472 2..60 295 100 Plus
Blast to na_te.dros performed 2019-03-15 18:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
hobo 2959 hobo DMHFL1 2959bp Derived from M69216 (g157606) (Rel. 41, Last updated, Version 3). 2305..2413 998..881 119 61.3 Minus

RH64960.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:58:22 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6157328..6157388 1..60 98 -> Plus
chr3R 6157445..6157544 61..160 100 -> Plus
chr3R 6157603..6158442 161..1000 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:20 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
CG12818-RA 1..867 38..904 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:07:04 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
CG12818-RA 1..867 38..904 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:37:31 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
CG12818-RA 1..867 38..904 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:20 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
CG12818-RA 1..867 38..904 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:06:06 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
CG12818-RA 1..867 38..904 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:03:31 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
CG12818-RA 1..1001 1..1000 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:07:04 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
CG12818-RA 1..1001 1..1000 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:37:31 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
CG12818-RA 1..1001 1..1000 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:20 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
CG12818-RA 1..1001 1..1000 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:06:06 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
CG12818-RA 1..1001 1..1000 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:22 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10331581..10331641 1..60 98 -> Plus
3R 10331698..10331797 61..160 100 -> Plus
3R 10331856..10332695 161..1000 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:22 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10331581..10331641 1..60 98 -> Plus
3R 10331698..10331797 61..160 100 -> Plus
3R 10331856..10332695 161..1000 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:22 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10331581..10331641 1..60 98 -> Plus
3R 10331698..10331797 61..160 100 -> Plus
3R 10331856..10332695 161..1000 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:37:31 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6157303..6157363 1..60 98 -> Plus
arm_3R 6157420..6157519 61..160 100 -> Plus
arm_3R 6157578..6158417 161..1000 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:22 Download gff for RH64960.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10072687..10073526 161..1000 99   Plus
3R 10072412..10072472 1..60 98 -> Plus
3R 10072529..10072628 61..160 100 -> Plus

RH64960.hyp Sequence

Translation from 0 to 903

> RH64960.hyp
NRLQECQQSGNKMNILPKKRWHVRTKENIARVRRDQAAAAAEEKVRQEKL
EFAESEARINFLRRQSGLPEKASKESREESQCSTETTKGVDLFADYKARV
KTTNKDLEKEQKEEQEKYEKQIGYLTYLGQDTNEALKVRSWYELAPKRPE
VGDPTATETHHKQKLAHDPLTLINALLPPEKKDPKKATKRIRERTPAPSQ
EPSIPHKDKKSKKDKKKHKSKNGSRETLLAEERIKREKLETLRRERMRRE
TAERQRSEALFAPKELPVAASAESTPASTPKVVQKYNSQFNPELAKQNML
*

RH64960.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12818-PA 288 CG12818-PA 1..288 13..300 1468 100 Plus
rudhira-PE 2075 CG43154-PE 1351..1596 7..258 152 21.6 Plus
rudhira-PC 2075 CG43154-PC 1351..1596 7..258 152 21.6 Plus

RH64960.pep Sequence

Translation from 37 to 903

> RH64960.pep
MNILPKKRWHVRTKENIARVRRDQAAAAAEEKVRQEKLEFAESEARINFL
RRQSGLPEKASKESREESQCSTETTKGVDLFADYKARVKTTNKDLEKEQK
EEQEKYEKQIGYLTYLGQDTNEALKVRSWYELAPKRPEVGDPTATETHHK
QKLAHDPLTLINALLPPEKKDPKKATKRIRERTPAPSQEPSIPHKDKKSK
KDKKKHKSKNGSRETLLAEERIKREKLETLRRERMRRETAERQRSEALFA
PKELPVAASAESTPASTPKVVQKYNSQFNPELAKQNML*

RH64960.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17525-PA 302 GF17525-PA 1..302 1..288 760 65 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17515-PA 290 GG17515-PA 1..290 1..288 1027 87.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19125-PA 309 GH19125-PA 1..309 1..288 797 61.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG12818-PA 288 CG12818-PA 1..288 1..288 1468 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23582-PA 310 GI23582-PA 1..310 1..288 646 56.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23690-PA 313 GL23690-PA 1..313 1..288 807 68.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11830-PB 289 GA11830-PB 1..289 1..288 821 71.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23875-PA 293 GM23875-PA 1..293 1..288 1172 91.1 Plus
Dsec\GM19585-PA 226 GM19585-PA 1..194 1..194 893 95.4 Plus
Dsec\GM19586-PA 54 GM19586-PA 1..54 235..288 197 92.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:52:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18685-PA 293 GD18685-PA 1..293 1..288 1420 94.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:52:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23556-PA 307 GJ23556-PA 1..307 1..288 691 60.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12831-PA 299 GK12831-PA 1..299 1..288 677 63.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26027-PA 289 GE26027-PA 1..289 1..287 967 84.4 Plus