Clone RH65663 Report

Search the DGRC for RH65663

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:656
Well:63
Vector:pFlc-1
Associated Gene/TranscriptCG12259-RA
Protein status:RH65663.pep: gold
Preliminary Size:1080
Sequenced Size:1244

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12259 2002-01-01 Sim4 clustering to Release 2
CG12259 2002-04-26 Blastp of sequenced clone
CG12259 2003-01-01 Sim4 clustering to Release 3
CG12259 2008-04-29 Release 5.5 accounting
CG12259 2008-08-15 Release 5.9 accounting
CG12259 2008-12-18 5.12 accounting

Clone Sequence Records

RH65663.complete Sequence

1244 bp (1244 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113617

> RH65663.complete
GACACCAATTGGATGTTTACAAATTTCGTTTACGAATTAAATAAAAAAAA
ATATAAATAAATACAGAAACAACTAAGGATGGCCCACTACAAAGGTGCCG
CCAGCGAGGCGGGCCGTGCAGCCCAGCTGATGAAGAAGCGGGAGATCCAG
CAGCAGGAGATCGAGTTTCGCAAGAAGAAGATCGAGGAGGAGCTCAAGCT
GGACAAGATTGAGAACAAGTTTGCCACCCACTACGATGCCGTGGAGCAGC
AGCTCAAGTCCTCGACCATTGGTCTGGTCACCCTCGACGAGATGAAGGCC
AAGCAGGAGGATATAGTGCGGGAACGGGAGAAGAAGCTCGCCCAGAAGAA
GGACGAAAAGGATCGGGAGAAGCAGCGCGCCCTGGAGGCCATTCAGGCGG
AGAAGAACAAGCAGAAGCGGCAGATCCAGGCGCTGTCCTTCAACCTGGAC
GACGACGAGGAGGAGGAGGAGGAGGACGACGAGGATCACGATAAGAAACA
GCTGAAGATTAAGCAGGAGGATCAGCCCAAGCCCAAGTGGACGGAGATCA
AGGAAGACATTTTGCCCATAAAGAAGAAGAAGATATGCAAGAATCCTGAC
GTGGACACTTCCTTTCTGCCAGATCGCGAGCGCGAGGAGCAGGAGAACAG
ACTGCGCGAGCAGCTGCGTCAAGAATGGGTAATGCAGCAGGCGGAGCTGA
AGGACGAGGACATCTCCATCACGTTCAGCTACTGGGATGGCTCCGGCCAT
CGGCGGAACGTGCTGATGAAGAAGGGCAACTCCATCTACCAGTTTCTGCA
GAAGTGCCTGGAGCTGCTGCGCAAGGAGTTCATCGAACTGAAGACCGTAA
TGGCCGACCAGCTGATGTACGTCAAGGAGGATCTGATCCTGCCGCACCAC
TATTCCTTCTACGACTTTATCGTGACCAAGGCACGCGGCAAATCCGGCCC
GCTCTTCCAGTTCGACGTCCACGACGATGTGCGCATGATAAGCGACGCCT
CCGTGGAGAAGGAGGAGTCCCATGCCGGAAAGGTACTCCTCCGCTCCTGG
TACGAGCGCAACAAGCACATCTTCCCAGCCAGCCGATGGGAGCCCTACGA
TCCCACCAAGTCCTACGACAAGTACACCATCAAGGACAAGGATAAGAGTA
AAAAGTAGTGCTTAGGGCAGTTTCTGCCCGAATAATTGTACAATATAATA
ATGATTGATTTAATACATCAAAACAAACGAAAAAAAAAAAAAAA

RH65663.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG12259-RA 1242 CG12259-RA 1..1233 2..1234 6165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23742805..23744032 1229..2 6095 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:36:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27919839..27921071 1234..2 6165 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27660670..27661902 1234..2 6165 100 Minus
Blast to na_te.dros performed 2019-03-15 16:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 7017..7076 76..17 138 70 Minus
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 5468..5530 675..735 130 69.8 Plus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 1030..1081 35..86 125 71.2 Plus
gypsy4 6852 gypsy4 GYPSY4 6852bp 5044..5077 35..68 116 82.4 Plus
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 4138..4174 29..65 113 78.4 Plus

RH65663.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:48:26 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23742805..23744032 1..1229 95   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:21 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
CG12259-RA 1..1080 79..1158 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:33 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
CG12259-RA 1..1080 79..1158 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:10:05 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
CG12259-RA 1..1080 79..1158 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:59 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
CG12259-RA 1..1080 79..1158 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:26 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
CG12259-RA 1..1080 79..1158 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:33:21 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
CG12259-RA 1..1228 2..1229 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:33 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
CG12259-RA 1..1228 2..1229 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:05 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
CG12259-RA 18..1246 1..1229 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:59 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
CG12259-RA 1..1228 2..1229 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:26 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
CG12259-RA 18..1246 1..1229 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:26 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27919844..27921071 1..1229 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:26 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27919844..27921071 1..1229 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:26 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27919844..27921071 1..1229 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:05 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23745566..23746793 1..1229 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:39 Download gff for RH65663.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27660675..27661902 1..1229 99   Minus

RH65663.pep Sequence

Translation from 78 to 1157

> RH65663.pep
MAHYKGAASEAGRAAQLMKKREIQQQEIEFRKKKIEEELKLDKIENKFAT
HYDAVEQQLKSSTIGLVTLDEMKAKQEDIVREREKKLAQKKDEKDREKQR
ALEAIQAEKNKQKRQIQALSFNLDDDEEEEEEDDEDHDKKQLKIKQEDQP
KPKWTEIKEDILPIKKKKICKNPDVDTSFLPDREREEQENRLREQLRQEW
VMQQAELKDEDISITFSYWDGSGHRRNVLMKKGNSIYQFLQKCLELLRKE
FIELKTVMADQLMYVKEDLILPHHYSFYDFIVTKARGKSGPLFQFDVHDD
VRMISDASVEKEESHAGKVLLRSWYERNKHIFPASRWEPYDPTKSYDKYT
IKDKDKSKK*

RH65663.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18003-PA 354 GF18003-PA 1..354 1..359 1699 92.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12085-PA 357 GG12085-PA 1..356 1..358 1718 94.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21791-PA 361 GH21791-PA 1..346 1..346 1627 90.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG12259-PA 359 CG12259-PA 1..359 1..359 1862 100 Plus
rudhira-PE 2075 CG43154-PE 1399..1574 13..199 158 25.7 Plus
rudhira-PC 2075 CG43154-PC 1399..1574 13..199 158 25.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21926-PA 357 GI21926-PA 1..347 1..351 1626 91.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24294-PA 358 GL24294-PA 1..358 1..359 1611 91.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11514-PA 358 GA11514-PA 1..358 1..359 1612 91.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16314-PA 359 GM16314-PA 1..359 1..359 1844 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18051-PA 359 GD18051-PA 1..359 1..359 1848 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14286-PA 357 GJ14286-PA 1..342 1..346 1614 92.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11956-PA 359 GK11956-PA 1..359 1..359 1659 92.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10531-PA 357 GE10531-PA 1..357 1..359 1808 96.7 Plus

RH65663.hyp Sequence

Translation from 78 to 1157

> RH65663.hyp
MAHYKGAASEAGRAAQLMKKREIQQQEIEFRKKKIEEELKLDKIENKFAT
HYDAVEQQLKSSTIGLVTLDEMKAKQEDIVREREKKLAQKKDEKDREKQR
ALEAIQAEKNKQKRQIQALSFNLDDDEEEEEEDDEDHDKKQLKIKQEDQP
KPKWTEIKEDILPIKKKKICKNPDVDTSFLPDREREEQENRLREQLRQEW
VMQQAELKDEDISITFSYWDGSGHRRNVLMKKGNSIYQFLQKCLELLRKE
FIELKTVMADQLMYVKEDLILPHHYSFYDFIVTKARGKSGPLFQFDVHDD
VRMISDASVEKEESHAGKVLLRSWYERNKHIFPASRWEPYDPTKSYDKYT
IKDKDKSKK*

RH65663.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12259-PA 359 CG12259-PA 1..359 1..359 1862 100 Plus
rudhira-PE 2075 CG43154-PE 1399..1574 13..199 158 25.7 Plus
rudhira-PC 2075 CG43154-PC 1399..1574 13..199 158 25.7 Plus