Clone RH65975 Report

Search the DGRC for RH65975

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:659
Well:75
Vector:pFlc-1
Associated Gene/TranscriptSrp19-RA
Protein status:RH65975.pep: gold
Preliminary Size:565
Sequenced Size:649

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4457 2002-01-01 Sim4 clustering to Release 2
CG4457 2002-02-22 Blastp of sequenced clone
CG4457 2003-01-01 Sim4 clustering to Release 3
Srp19 2008-04-29 Release 5.5 accounting
Srp19 2008-08-15 Release 5.9 accounting
Srp19 2008-12-18 5.12 accounting

Clone Sequence Records

RH65975.complete Sequence

649 bp (649 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089689

> RH65975.complete
GAATTGGGTTGCTTGCGTGGAAAATAGCTTTCTAGCTCATTTTTTGTTAA
TTACACAGGAATTGCAATAAACCAACCAAGAATTCACTGAAAGAATGGCG
ACAGCAGTTCCCATGAAAAAAAACTGGAGCCCCAGCATGAAACACAACGA
TATGGAGCGATGGATTTGCATATATCCCGCCTACATCAATAGGAAAAAGA
CACGCCAGGAGGGTCGACGGCTGCCCAAGGAGAACTGTGTAGACAATCCC
AGCTATATTGAGATTCGCGATGTGCTGTCCGTTTCCAACTTGCAGTTCCT
CATGGAGAACAAGAAGTACTGTCGCGAGAACAGCAGCGAGATGGAGTTCC
GTGGTCGTGTGCGCGTCCAGCTGCGTAATGTCGATGGCACTTTGTACAAT
AATGACTTTCCCACGCGCGAGTCCATCATGCTGCATATCGCCAGCAAGAT
ACCGCAGCTGAAGACGCGACAGAACAAATCCGGCGACTCGTACCACCAGC
AGTCGCAGCCACAGTCGAATGCATCCGGATCTGGGGGTGGTGGTGGCGGC
AAGAAGGGAAAGGGCAAGCGCCGCTAATGACTTCAGTGGCAACTCGTAGT
TTGGTTTCTTTTGTAATAAACGCTGTAAACAAAGAAAAAAAAAAAAAAA

RH65975.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Srp19-RA 716 Srp19-RA 22..655 2..635 3155 99.8 Plus
Srp19.b 611 Srp19.b 169..611 192..634 2200 99.7 Plus
Srp19.a 658 Srp19.a 217..658 193..634 2195 99.7 Plus
Srp19.b 611 Srp19.b 12..169 2..159 790 100 Plus
Srp19.a 658 Srp19.a 12..169 2..159 790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7339442..7339917 634..159 2365 99.8 Minus
chr3L 24539361 chr3L 7339989..7340146 159..2 790 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:36:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7347309..7347785 635..159 2370 99.8 Minus
3L 28110227 3L 7347857..7348014 159..2 790 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7340409..7340885 635..159 2370 99.7 Minus
3L 28103327 3L 7340957..7341114 159..2 790 100 Minus
Blast to na_te.dros performed 2019-03-15 20:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1468..1522 18..72 113 67.3 Plus

RH65975.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:39:31 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7339442..7339916 160..634 99 <- Minus
chr3L 7339989..7340146 1..159 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:28 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
Srp19-RA 1..483 95..577 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:21 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
Srp19-RA 1..483 95..577 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:16:48 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
Srp19-RA 1..483 95..577 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:52 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
Srp19-RA 1..483 95..577 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:25:12 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
Srp19-RA 1..483 95..577 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:09 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
Srp19-RA 1..633 2..634 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:21 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
Srp19-RA 11..644 1..634 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:16:48 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
Srp19-RA 20..653 1..634 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:52 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
Srp19-RA 1..633 2..634 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:25:12 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
Srp19-RA 20..653 1..634 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:31 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7347310..7347784 160..634 99 <- Minus
3L 7347857..7348014 1..159 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:31 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7347310..7347784 160..634 99 <- Minus
3L 7347857..7348014 1..159 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:31 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7347310..7347784 160..634 99 <- Minus
3L 7347857..7348014 1..159 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:16:48 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7340410..7340884 160..634 99 <- Minus
arm_3L 7340957..7341114 1..159 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:36 Download gff for RH65975.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7340410..7340884 160..634 99 <- Minus
3L 7340957..7341114 1..159 99   Minus

RH65975.pep Sequence

Translation from 94 to 576

> RH65975.pep
MATAVPMKKNWSPSMKHNDMERWICIYPAYINRKKTRQEGRRLPKENCVD
NPSYIEIRDVLSVSNLQFLMENKKYCRENSSEMEFRGRVRVQLRNVDGTL
YNNDFPTRESIMLHIASKIPQLKTRQNKSGDSYHQQSQPQSNASGSGGGG
GGKKGKGKRR*

RH65975.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25121-PA 162 GF25121-PA 1..134 1..134 639 83.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14974-PA 161 GG14974-PA 1..143 1..143 688 86.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16090-PA 161 GH16090-PA 1..138 1..141 571 72.3 Plus
Dgri\GH23602-PA 102 GH23602-PA 19..79 78..141 214 67.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Srp19-PA 160 CG4457-PA 1..160 1..160 853 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12354-PA 156 GI12354-PA 1..137 1..140 564 72.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21099-PA 165 GL21099-PA 1..135 1..135 546 73.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18198-PA 169 GA18198-PA 1..135 1..135 548 73.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13769-PA 160 GM13769-PA 1..143 1..143 743 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13067-PA 160 GD13067-PA 1..143 1..143 748 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12246-PA 158 GJ12246-PA 1..139 1..142 569 72.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16666-PA 166 GK16666-PA 1..130 1..130 568 74.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20421-PA 161 GE20421-PA 1..131 1..131 623 87 Plus

RH65975.hyp Sequence

Translation from 94 to 576

> RH65975.hyp
MATAVPMKKNWSPSMKHNDMERWICIYPAYINRKKTRQEGRRLPKENCVD
NPSYIEIRDVLSVSNLQFLMENKKYCRENSSEMEFRGRVRVQLRNVDGTL
YNNDFPTRESIMLHIASKIPQLKTRQNKSGDSYHQQSQPQSNASGSGGGG
GGKKGKGKRR*

RH65975.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
Srp19-PA 160 CG4457-PA 1..160 1..160 853 100 Plus