Clone RH66170 Report

Search the DGRC for RH66170

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:661
Well:70
Vector:pFlc-1
Associated Gene/TranscriptNHP2-RA
Protein status:RH66170.pep: gold
Preliminary Size:659
Sequenced Size:682

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5258 2002-01-01 Sim4 clustering to Release 2
CG5258 2003-01-01 Sim4 clustering to Release 3
NHP2 2008-04-29 Release 5.5 accounting
NHP2 2008-08-15 Release 5.9 accounting
NHP2 2008-12-18 5.12 accounting

Clone Sequence Records

RH66170.complete Sequence

682 bp (682 high quality bases) assembled on 2005-08-03

GenBank Submission: BT023752

> RH66170.complete
GCGCGGTCACACTGAACACGTGTTTCGAACAAAAAGCCGTTTAAACAAAA
TATCCACGTTTTTATCAAAAAAGCAATGGGCAAAGTGAAAGTAGAGCGCT
CCGAGGATGCCGATGAGTCCGTTGTGGCCAGCGGCGATGTTACCATCAAG
GAGGAGGAGTCCTACGACGACAAGCTGATCTTTGTGAACGCCATCGCGAA
ACCGATGGCAGGTAAAAAACTGGCCAAAAAGTGCTACAAACTGGTGAAGA
AGGCCATGAAGCACAAGACTTTCCTGCGAAATGGACTTAAGGATGTACAG
ACTCGCCTGCGCAAGGGCGAAACTGGCATTTGCATCTTTGCTGGCGACGT
TACACCTGTGGACATCATGTGCCACTTACCAGCCGTCTGCGAGGAGAAGG
GCATCCCCTATACCTACACCCCCAGTCGAGCGGATCTTGGAGCTGCCATG
GGCGTGAAGCGCGGTACAGTCGCCCTGCTGGTCCGCCAGAACGAGGAGTA
CAAGGATCTGTACGACGAGGTCAAGGAGGAGCTGTCTGCACTAAACATAC
CCGTCTAGATCTGTAGGATTAGTTCCATCGGCTAATTAAGTACCTAGTTA
AGTTCAAAAAGTACCAATAAACTTCGGAGAATGCCGATTCTTTTGGCATC
ACGAAATCAATTTGACAAAAAAAAAAAAAAAA

RH66170.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
NHP2-RA 886 NHP2-RA 47..714 2..669 3325 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14791572..14791911 665..326 1700 100 Minus
chr3L 24539361 chr3L 14791971..14792295 326..2 1625 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:36:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14801437..14801780 669..326 1705 99.7 Minus
3L 28110227 3L 14801840..14802164 326..2 1625 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14794537..14794880 669..326 1705 99.7 Minus
3L 28103327 3L 14794940..14795264 326..2 1625 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:39:29 has no hits.

RH66170.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:40:13 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14791571..14791910 327..666 99 <- Minus
chr3L 14791971..14792295 1..326 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:29 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
NHP2-RA 1..483 76..558 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:55:42 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
NHP2-RA 1..483 76..558 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:06:57 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
NHP2-RA 1..483 76..558 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:36:23 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
NHP2-RA 1..483 76..558 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:30:37 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
NHP2-RA 1..483 76..558 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:32:26 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
NHP2-RA 25..689 1..666 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:55:42 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
NHP2-RA 25..689 1..666 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:06:57 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
NHP2-RB 4..668 1..666 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:36:23 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
NHP2-RA 25..689 1..666 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:30:37 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
NHP2-RB 4..668 1..666 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:13 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14801440..14801779 327..666 99 <- Minus
3L 14801840..14802164 1..326 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:13 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14801440..14801779 327..666 99 <- Minus
3L 14801840..14802164 1..326 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:13 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14801440..14801779 327..666 99 <- Minus
3L 14801840..14802164 1..326 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:06:57 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14794940..14795264 1..326 99   Minus
arm_3L 14794540..14794879 327..666 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:14:59 Download gff for RH66170.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14794540..14794879 327..666 99 <- Minus
3L 14794940..14795264 1..326 99   Minus

RH66170.pep Sequence

Translation from 75 to 557

> RH66170.pep
MGKVKVERSEDADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLA
KKCYKLVKKAMKHKTFLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCH
LPAVCEEKGIPYTYTPSRADLGAAMGVKRGTVALLVRQNEEYKDLYDEVK
EELSALNIPV*

RH66170.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25179-PA 160 GF25179-PA 1..160 1..160 770 90 Plus
Dana\GF22789-PA 127 GF22789-PA 5..125 37..156 198 35.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13705-PA 160 GG13705-PA 1..160 1..160 808 96.2 Plus
Dere\GG10048-PA 127 GG10048-PA 5..125 37..156 197 35.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14629-PA 160 GH14629-PA 1..160 1..160 766 88.1 Plus
Dgri\GH25137-PA 127 GH25137-PA 5..125 37..156 198 35.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
NHP2-PB 160 CG5258-PB 1..160 1..160 818 100 Plus
NHP2-PA 160 CG5258-PA 1..160 1..160 818 100 Plus
hoip-PB 127 CG3949-PB 5..125 37..156 194 35.2 Plus
hoip-PA 127 CG3949-PA 5..125 37..156 194 35.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11341-PA 160 GI11341-PA 1..160 1..160 738 86.9 Plus
Dmoj\GI20000-PA 127 GI20000-PA 5..125 37..156 198 35.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24587-PA 160 GL24587-PA 1..160 1..160 769 90 Plus
Dper\GL18927-PA 147 GL18927-PA 25..145 37..156 198 35.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18767-PA 160 GA18767-PA 1..160 1..160 769 90 Plus
Dpse\GA17798-PA 147 GA17798-PA 25..145 37..156 198 35.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24527-PA 160 GM24527-PA 1..160 1..160 834 100 Plus
Dsec\GM17636-PA 127 GM17636-PA 5..125 37..156 197 35.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12597-PA 178 GD12597-PA 1..178 1..160 762 85.4 Plus
Dsim\GD23622-PA 127 GD23622-PA 5..125 37..156 197 35.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11595-PA 160 GJ11595-PA 1..160 1..160 745 88.1 Plus
Dvir\GJ13428-PA 106 GJ13428-PA 2..104 55..156 171 34.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10536-PA 160 GK10536-PA 1..160 1..160 766 90.6 Plus
Dwil\GK24184-PA 127 GK24184-PA 5..125 37..156 196 35.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\NHP2-PA 160 GE20000-PA 1..160 1..160 816 98.1 Plus
Dyak\GE18862-PA 127 GE18862-PA 5..125 37..156 197 35.2 Plus

RH66170.hyp Sequence

Translation from 75 to 557

> RH66170.hyp
MGKVKVERSEDADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLA
KKCYKLVKKAMKHKTFLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCH
LPAVCEEKGIPYTYTPSRADLGAAMGVKRGTVALLVRQNEEYKDLYDEVK
EELSALNIPV*

RH66170.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
NHP2-PB 160 CG5258-PB 1..160 1..160 818 100 Plus
NHP2-PA 160 CG5258-PA 1..160 1..160 818 100 Plus
hoip-PB 127 CG3949-PB 5..125 37..156 194 35.2 Plus
hoip-PA 127 CG3949-PA 5..125 37..156 194 35.2 Plus