Clone RH66629 Report

Search the DGRC for RH66629

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:666
Well:29
Vector:pFlc-1
Associated Gene/TranscriptCG11858-RA
Protein status:RH66629.pep: gold
Preliminary Size:393
Sequenced Size:504

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11858 2001-12-17 Blastp of sequenced clone
CG11858 2002-01-01 Sim4 clustering to Release 2
CG11858 2003-01-01 Sim4 clustering to Release 3
CG11858 2008-04-29 Release 5.5 accounting
CG11858 2008-08-15 Release 5.9 accounting
CG11858 2008-12-18 5.12 accounting

Clone Sequence Records

RH66629.complete Sequence

504 bp (504 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071761

> RH66629.complete
GATGTGTCTGCTCCAACCAAACTGTTTACTTGTTTCGAATTTGCAATTTA
AAAACATTGAACGAAAATGCCACCGAAAAAGGATGCGAAGAGTGGAAAGG
ATGCAGGGAAAGGTGGCAAAAAGCCAGCCGCCGAAGACAAGTCTGCCGGT
AAGGAGAAGAAGGGAGGCAATGCTGTAAAGGTTCGTCACATCTTGTGCGA
GAAGCAGGGCAAGATCACCGAAGCGATGGAGAAGCTAAAGGCAGGCCAAA
AATTCCCCGAGGTAGCGGCTGCTTACAGCGAGGACAAGGCGCGACAAGGC
GGCGATCTCGGATGGCAGATCCGAGGAGCGATGGTGGGCCCATTTCAGGA
CGCCGCCTTCGCATTGCCCATCTCCACTGTCAACAATCCCGTGTACACAG
ATCCCCCGATTAAGACCAAGTTTGGCTACCACATCATCATGGTGGAGGGA
AAGAAATGAACATTGATTTTATAAATCGAATTTTAATGTGAAAAAAAAAA
AAAA

RH66629.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG11858-RA 573 CG11858-RA 82..571 2..491 2450 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21086028..21086375 143..490 1740 100 Plus
chr3R 27901430 chr3R 21085828..21085968 2..142 705 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25262945..25263293 143..491 1745 100 Plus
3R 32079331 3R 25262745..25262885 2..142 705 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25003776..25004124 143..491 1745 100 Plus
3R 31820162 3R 25003576..25003716 2..142 705 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:46:41 has no hits.

RH66629.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:47:19 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21085826..21085968 1..142 99 -> Plus
chr3R 21086028..21086375 143..490 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:39 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 1..393 67..459 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:24 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 1..393 67..459 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:20:35 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 1..393 67..459 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:08 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 1..393 67..459 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:11 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 1..393 67..459 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:23:22 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 1..491 1..490 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:24 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 1..491 1..490 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:20:35 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 3..493 1..490 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:08 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 1..491 1..490 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:11 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 3..493 1..490 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:19 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25262743..25262885 1..142 99 -> Plus
3R 25262945..25263292 143..490 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:19 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25262743..25262885 1..142 99 -> Plus
3R 25262945..25263292 143..490 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:19 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25262743..25262885 1..142 99 -> Plus
3R 25262945..25263292 143..490 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:20:35 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21088465..21088607 1..142 99 -> Plus
arm_3R 21088667..21089014 143..490 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:11 Download gff for RH66629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25003776..25004123 143..490 100   Plus
3R 25003574..25003716 1..142 99 -> Plus

RH66629.hyp Sequence

Translation from 66 to 458

> RH66629.hyp
MPPKKDAKSGKDAGKGGKKPAAEDKSAGKEKKGGNAVKVRHILCEKQGKI
TEAMEKLKAGQKFPEVAAAYSEDKARQGGDLGWQIRGAMVGPFQDAAFAL
PISTVNNPVYTDPPIKTKFGYHIIMVEGKK*

RH66629.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11858-PA 130 CG11858-PA 1..130 1..130 682 100 Plus

RH66629.pep Sequence

Translation from 66 to 458

> RH66629.pep
MPPKKDAKSGKDAGKGGKKPAAEDKSAGKEKKGGNAVKVRHILCEKQGKI
TEAMEKLKAGQKFPEVAAAYSEDKARQGGDLGWQIRGAMVGPFQDAAFAL
PISTVNNPVYTDPPIKTKFGYHIIMVEGKK*

RH66629.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17558-PA 130 GF17558-PA 1..130 1..130 661 99.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11384-PA 130 GG11384-PA 1..130 1..130 661 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22285-PA 130 GH22285-PA 1..130 1..130 563 90 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG11858-PA 130 CG11858-PA 1..130 1..130 682 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23093-PA 56 GI23093-PA 1..52 1..52 171 88.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21710-PA 130 GL21710-PA 1..130 1..130 646 96.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11241-PA 130 GA11241-PA 1..130 1..130 579 95.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17827-PA 126 GM17827-PA 1..126 5..130 636 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21195-PA 130 GD21195-PA 1..130 1..130 657 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22713-PA 130 GJ22713-PA 1..130 1..130 514 93.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12925-PA 129 GK12925-PA 22..129 23..130 557 98.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23581-PA 130 GE23581-PA 1..130 1..130 661 99.2 Plus