BDGP Sequence Production Resources |
Search the DGRC for RH66629
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 666 |
Well: | 29 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG11858-RA |
Protein status: | RH66629.pep: gold |
Preliminary Size: | 393 |
Sequenced Size: | 504 |
Gene | Date | Evidence |
---|---|---|
CG11858 | 2001-12-17 | Blastp of sequenced clone |
CG11858 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11858 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11858 | 2008-04-29 | Release 5.5 accounting |
CG11858 | 2008-08-15 | Release 5.9 accounting |
CG11858 | 2008-12-18 | 5.12 accounting |
504 bp (504 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071761
> RH66629.complete GATGTGTCTGCTCCAACCAAACTGTTTACTTGTTTCGAATTTGCAATTTA AAAACATTGAACGAAAATGCCACCGAAAAAGGATGCGAAGAGTGGAAAGG ATGCAGGGAAAGGTGGCAAAAAGCCAGCCGCCGAAGACAAGTCTGCCGGT AAGGAGAAGAAGGGAGGCAATGCTGTAAAGGTTCGTCACATCTTGTGCGA GAAGCAGGGCAAGATCACCGAAGCGATGGAGAAGCTAAAGGCAGGCCAAA AATTCCCCGAGGTAGCGGCTGCTTACAGCGAGGACAAGGCGCGACAAGGC GGCGATCTCGGATGGCAGATCCGAGGAGCGATGGTGGGCCCATTTCAGGA CGCCGCCTTCGCATTGCCCATCTCCACTGTCAACAATCCCGTGTACACAG ATCCCCCGATTAAGACCAAGTTTGGCTACCACATCATCATGGTGGAGGGA AAGAAATGAACATTGATTTTATAAATCGAATTTTAATGTGAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11858-RA | 573 | CG11858-RA | 82..571 | 2..491 | 2450 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 21085826..21085968 | 1..142 | 99 | -> | Plus |
chr3R | 21086028..21086375 | 143..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11858-RA | 1..393 | 67..459 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11858-RA | 1..393 | 67..459 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11858-RA | 1..393 | 67..459 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11858-RA | 1..393 | 67..459 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11858-RA | 1..393 | 67..459 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11858-RA | 1..491 | 1..490 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11858-RA | 1..491 | 1..490 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11858-RA | 3..493 | 1..490 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11858-RA | 1..491 | 1..490 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11858-RA | 3..493 | 1..490 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25262743..25262885 | 1..142 | 99 | -> | Plus |
3R | 25262945..25263292 | 143..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25262743..25262885 | 1..142 | 99 | -> | Plus |
3R | 25262945..25263292 | 143..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25262743..25262885 | 1..142 | 99 | -> | Plus |
3R | 25262945..25263292 | 143..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 21088465..21088607 | 1..142 | 99 | -> | Plus |
arm_3R | 21088667..21089014 | 143..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25003776..25004123 | 143..490 | 100 | Plus | |
3R | 25003574..25003716 | 1..142 | 99 | -> | Plus |
Translation from 66 to 458
> RH66629.hyp MPPKKDAKSGKDAGKGGKKPAAEDKSAGKEKKGGNAVKVRHILCEKQGKI TEAMEKLKAGQKFPEVAAAYSEDKARQGGDLGWQIRGAMVGPFQDAAFAL PISTVNNPVYTDPPIKTKFGYHIIMVEGKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11858-PA | 130 | CG11858-PA | 1..130 | 1..130 | 682 | 100 | Plus |
Translation from 66 to 458
> RH66629.pep MPPKKDAKSGKDAGKGGKKPAAEDKSAGKEKKGGNAVKVRHILCEKQGKI TEAMEKLKAGQKFPEVAAAYSEDKARQGGDLGWQIRGAMVGPFQDAAFAL PISTVNNPVYTDPPIKTKFGYHIIMVEGKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17558-PA | 130 | GF17558-PA | 1..130 | 1..130 | 661 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11384-PA | 130 | GG11384-PA | 1..130 | 1..130 | 661 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22285-PA | 130 | GH22285-PA | 1..130 | 1..130 | 563 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11858-PA | 130 | CG11858-PA | 1..130 | 1..130 | 682 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23093-PA | 56 | GI23093-PA | 1..52 | 1..52 | 171 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21710-PA | 130 | GL21710-PA | 1..130 | 1..130 | 646 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11241-PA | 130 | GA11241-PA | 1..130 | 1..130 | 579 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17827-PA | 126 | GM17827-PA | 1..126 | 5..130 | 636 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21195-PA | 130 | GD21195-PA | 1..130 | 1..130 | 657 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22713-PA | 130 | GJ22713-PA | 1..130 | 1..130 | 514 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12925-PA | 129 | GK12925-PA | 22..129 | 23..130 | 557 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23581-PA | 130 | GE23581-PA | 1..130 | 1..130 | 661 | 99.2 | Plus |