Clone RH67033 Report

Search the DGRC for RH67033

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:670
Well:33
Vector:pFlc-1
Associated Gene/TranscriptIM23-RA
Protein status:RH67033.pep: gold
Preliminary Size:405
Sequenced Size:480

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15066 2001-12-17 Blastp of sequenced clone
CG15066 2002-01-01 Sim4 clustering to Release 2
CG15066 2003-01-01 Sim4 clustering to Release 3
IM23 2008-04-29 Release 5.5 accounting
IM23 2008-08-15 Release 5.9 accounting
IM23 2008-12-18 5.12 accounting

Clone Sequence Records

RH67033.complete Sequence

480 bp (480 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071762

> RH67033.complete
GAGATTCGTCTTGCACGCAGATTGAGAATGAAGTGCCTGATTCTGTCCTT
TGCAATTTTCGTTGTCCTGGCTTCCCAGGCTACGGCCGGAAATGTGATTA
TCGGCGGAGTATGCCAGGATTGCAGTCCGCCGGTGGCGGAAAACGTCGTA
GTCGGTGGCCAATCCTACAGGACGGGTAGGCCGGGCCAGGGAACGGTGTA
TATCAATTCCCCTGGCGCATATCTAGGAGCTCTCGATGGTCCCATTCGGC
GAACTGGCGCTGGCGGCGGAGGAGGCGGTGGCGCCCAGTATCCGGATGGT
TACAGTGGTCGTCTGCCAGGTGGCACTTACCTTCACAATAAGGATTGCGT
GGGCTGCAGCATCAGCGGGGGCGGGGATTAACGAAATTATATTGTGATTT
GTACATAAAATACCTCGCATTTTTTAATTTTCGGGCATAATTTATAATTC
TTTAAAAAATCCGAAAAAAAAAAAAAAAAA

RH67033.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
IM23-RA 729 IM23-RA 151..616 2..467 2315 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14269741..14270117 461..85 1780 98.1 Minus
chr2R 21145070 chr2R 14270181..14270264 85..2 405 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18382700..18383082 467..85 1900 99.7 Minus
2R 25286936 2R 18383146..18383229 85..2 420 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18383899..18384281 467..85 1900 99.7 Minus
2R 25260384 2R 18384345..18384428 85..2 420 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:47:35 has no hits.

RH67033.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:48:28 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14269739..14270116 86..463 97 <- Minus
chr2R 14270181..14270264 1..85 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:43 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
IM23-RA 1..354 28..381 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:43 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
IM23-RA 1..354 28..381 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:10:10 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
IM23-RA 1..354 28..381 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:28 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
IM23-RA 1..354 28..381 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:34 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
IM23-RA 1..354 28..381 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:23:58 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
IM23-RA 3..465 1..463 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:43 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
IM23-RA 3..465 1..463 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:10 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
IM23-RA 6..468 1..463 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:28 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
IM23-RA 3..465 1..463 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:34 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
IM23-RA 6..468 1..463 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:28 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18382704..18383081 86..463 99 <- Minus
2R 18383146..18383229 1..85 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:28 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18382704..18383081 86..463 99 <- Minus
2R 18383146..18383229 1..85 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:28 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18382704..18383081 86..463 99 <- Minus
2R 18383146..18383229 1..85 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:10 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14270209..14270586 86..463 99 <- Minus
arm_2R 14270651..14270734 1..85 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:32 Download gff for RH67033.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18383903..18384280 86..463 99 <- Minus
2R 18384345..18384428 1..85 98   Minus

RH67033.hyp Sequence

Translation from 3 to 380

> RH67033.hyp
IRLARRLRMKCLILSFAIFVVLASQATAGNVIIGGVCQDCSPPVAENVVV
GGQSYRTGRPGQGTVYINSPGAYLGALDGPIRRTGAGGGGGGGAQYPDGY
SGRLPGGTYLHNKDCVGCSISGGGD*

RH67033.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
IM23-PA 117 CG15066-PA 1..117 9..125 631 100 Plus

RH67033.pep Sequence

Translation from 27 to 380

> RH67033.pep
MKCLILSFAIFVVLASQATAGNVIIGGVCQDCSPPVAENVVVGGQSYRTG
RPGQGTVYINSPGAYLGALDGPIRRTGAGGGGGGGAQYPDGYSGRLPGGT
YLHNKDCVGCSISGGGD*

RH67033.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12769-PA 125 GF12769-PA 1..125 1..117 414 77.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20976-PA 117 GG20976-PA 1..117 1..117 479 86.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20222-PA 126 GH20222-PA 3..126 5..114 239 46.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
IM23-PA 117 CG15066-PA 1..117 1..117 631 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19391-PA 101 GI19391-PA 20..101 22..114 215 52.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16707-PA 91 GL16707-PA 1..69 1..69 209 62.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24273-PA 91 GA24273-PA 1..69 1..69 205 60.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19911-PA 117 GM19911-PA 1..117 1..117 528 90.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22454-PA 105 GJ22454-PA 19..105 21..114 224 53.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23237-PA 113 GK23237-PA 6..113 4..117 262 54.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13917-PA 117 GE13917-PA 1..117 1..117 432 81.2 Plus