BDGP Sequence Production Resources |
Search the DGRC for RH67033
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 670 |
Well: | 33 |
Vector: | pFlc-1 |
Associated Gene/Transcript | IM23-RA |
Protein status: | RH67033.pep: gold |
Preliminary Size: | 405 |
Sequenced Size: | 480 |
Gene | Date | Evidence |
---|---|---|
CG15066 | 2001-12-17 | Blastp of sequenced clone |
CG15066 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15066 | 2003-01-01 | Sim4 clustering to Release 3 |
IM23 | 2008-04-29 | Release 5.5 accounting |
IM23 | 2008-08-15 | Release 5.9 accounting |
IM23 | 2008-12-18 | 5.12 accounting |
480 bp (480 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071762
> RH67033.complete GAGATTCGTCTTGCACGCAGATTGAGAATGAAGTGCCTGATTCTGTCCTT TGCAATTTTCGTTGTCCTGGCTTCCCAGGCTACGGCCGGAAATGTGATTA TCGGCGGAGTATGCCAGGATTGCAGTCCGCCGGTGGCGGAAAACGTCGTA GTCGGTGGCCAATCCTACAGGACGGGTAGGCCGGGCCAGGGAACGGTGTA TATCAATTCCCCTGGCGCATATCTAGGAGCTCTCGATGGTCCCATTCGGC GAACTGGCGCTGGCGGCGGAGGAGGCGGTGGCGCCCAGTATCCGGATGGT TACAGTGGTCGTCTGCCAGGTGGCACTTACCTTCACAATAAGGATTGCGT GGGCTGCAGCATCAGCGGGGGCGGGGATTAACGAAATTATATTGTGATTT GTACATAAAATACCTCGCATTTTTTAATTTTCGGGCATAATTTATAATTC TTTAAAAAATCCGAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IM23-RA | 729 | IM23-RA | 151..616 | 2..467 | 2315 | 99.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 14269739..14270116 | 86..463 | 97 | <- | Minus |
chr2R | 14270181..14270264 | 1..85 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM23-RA | 1..354 | 28..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM23-RA | 1..354 | 28..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM23-RA | 1..354 | 28..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM23-RA | 1..354 | 28..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM23-RA | 1..354 | 28..381 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM23-RA | 3..465 | 1..463 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM23-RA | 3..465 | 1..463 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM23-RA | 6..468 | 1..463 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM23-RA | 3..465 | 1..463 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM23-RA | 6..468 | 1..463 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18382704..18383081 | 86..463 | 99 | <- | Minus |
2R | 18383146..18383229 | 1..85 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18382704..18383081 | 86..463 | 99 | <- | Minus |
2R | 18383146..18383229 | 1..85 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18382704..18383081 | 86..463 | 99 | <- | Minus |
2R | 18383146..18383229 | 1..85 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 14270209..14270586 | 86..463 | 99 | <- | Minus |
arm_2R | 14270651..14270734 | 1..85 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18383903..18384280 | 86..463 | 99 | <- | Minus |
2R | 18384345..18384428 | 1..85 | 98 | Minus |
Translation from 3 to 380
> RH67033.hyp IRLARRLRMKCLILSFAIFVVLASQATAGNVIIGGVCQDCSPPVAENVVV GGQSYRTGRPGQGTVYINSPGAYLGALDGPIRRTGAGGGGGGGAQYPDGY SGRLPGGTYLHNKDCVGCSISGGGD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IM23-PA | 117 | CG15066-PA | 1..117 | 9..125 | 631 | 100 | Plus |
Translation from 27 to 380
> RH67033.pep MKCLILSFAIFVVLASQATAGNVIIGGVCQDCSPPVAENVVVGGQSYRTG RPGQGTVYINSPGAYLGALDGPIRRTGAGGGGGGGAQYPDGYSGRLPGGT YLHNKDCVGCSISGGGD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12769-PA | 125 | GF12769-PA | 1..125 | 1..117 | 414 | 77.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20976-PA | 117 | GG20976-PA | 1..117 | 1..117 | 479 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20222-PA | 126 | GH20222-PA | 3..126 | 5..114 | 239 | 46.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IM23-PA | 117 | CG15066-PA | 1..117 | 1..117 | 631 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19391-PA | 101 | GI19391-PA | 20..101 | 22..114 | 215 | 52.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16707-PA | 91 | GL16707-PA | 1..69 | 1..69 | 209 | 62.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24273-PA | 91 | GA24273-PA | 1..69 | 1..69 | 205 | 60.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19911-PA | 117 | GM19911-PA | 1..117 | 1..117 | 528 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22454-PA | 105 | GJ22454-PA | 19..105 | 21..114 | 224 | 53.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23237-PA | 113 | GK23237-PA | 6..113 | 4..117 | 262 | 54.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13917-PA | 117 | GE13917-PA | 1..117 | 1..117 | 432 | 81.2 | Plus |