Clone RH67410 Report

Search the DGRC for RH67410

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:674
Well:10
Vector:pFlc-1
Associated Gene/TranscriptObp19b-RA
Protein status:RH67410.pep: gold
Preliminary Size:803
Sequenced Size:667

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1670 2001-12-17 Blastp of sequenced clone
CG1670 2002-01-01 Sim4 clustering to Release 2
CG1670 2003-01-01 Sim4 clustering to Release 3
Obp19b 2008-04-29 Release 5.5 accounting
Obp19b 2008-08-15 Release 5.9 accounting
Obp19b 2008-12-18 5.12 accounting

Clone Sequence Records

RH67410.complete Sequence

667 bp (667 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071763

> RH67410.complete
GACTATTCACAAGAAGAGCAAAAATGATGCAGTGCAGCCGAATGACGACG
ACGTTGAAGATGACGAACCTTCTGCTAGCAGTGGCCTGCGCCGCCGTGCT
GATGGGATCGGCGACGGCGGACGAGGAGGAGGGGTCCATGACCGTGGACG
AGGTGGTGGAGCTGATCGAGCCCTTTGGCGACGCCTGCACGCCAAAGCCG
TCGAGGGAGAACATCGTCGAGATGGTGCTGAACAAGGAGGACGCCAAGCA
CGAGACCAAGTGCTTCCGCCACTGCATGCTGGAGCAGTTCGAGCTGATGC
CCGAGGATCAGTTGCAGTATAACGAGGACAAGACGGTCGATATGATCAAC
ATGATGTTCCCGGATCGCGAGGACGACGGCAGGCGCATCGTCAAGACCTG
CAACGAGGAGCTAAAGGCCGAGCAGGACAAGTGCGAGGCAGCCCACGGGA
TCGCTATGTGCATGCTGCGCGAGATGCGCTCTTCGGGCTTCAAGATTCCC
GAGATCAAGGAATGAGGCCATGGAGCTGCTCGCTGGCCCACCATTGCATG
TTCTCCCTCCCTTTTTTTTTTGTTAGTGATTCAGTTCGATTTAATTACCA
AAGCTAGAGAACTTGGAGTGGTTTCCCAAACTAATAAAGCGCCCAACCAA
CAAAAAAAAAAAAAAAA

RH67410.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19b-RA 659 Obp19b-RA 5..656 2..653 3260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20282477..20282703 207..433 1120 99.6 Plus
chrX 22417052 chrX 20283085..20283305 431..651 1105 100 Plus
chrX 22417052 chrX 20282207..20282412 2..207 1030 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20416993..20417219 207..433 1135 100 Plus
X 23542271 X 20417587..20417809 431..653 1115 100 Plus
X 23542271 X 20416723..20416928 2..207 1030 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20402085..20402311 207..433 1135 100 Plus
X 23527363 X 20402679..20402901 431..653 1115 100 Plus
X 23527363 X 20401815..20402020 2..207 1030 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:47:37 has no hits.

RH67410.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:48:29 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20282478..20282700 208..430 99 -> Plus
chrX 20282206..20282412 1..207 99 -> Plus
chrX 20283085..20283305 431..651 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:46 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19b-RA 1..492 24..515 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:10 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19b-RA 1..492 24..515 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:10:13 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19b-RA 1..492 24..515 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:54 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19b-RA 1..492 24..515 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:38 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19b-RA 1..492 24..515 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:23:05 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19b-RA 2..651 2..651 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:10 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19b-RA 2..651 2..651 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:13 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19b-RA 1..640 12..651 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:54 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19b-RA 2..651 2..651 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:38 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19b-RA 1..640 12..651 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:29 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
X 20416722..20416928 1..207 99 -> Plus
X 20416994..20417216 208..430 100 -> Plus
X 20417587..20417807 431..651 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:29 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
X 20416722..20416928 1..207 99 -> Plus
X 20416994..20417216 208..430 100 -> Plus
X 20417587..20417807 431..651 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:29 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
X 20416722..20416928 1..207 99 -> Plus
X 20416994..20417216 208..430 100 -> Plus
X 20417587..20417807 431..651 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:13 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20287749..20287955 1..207 99 -> Plus
arm_X 20288021..20288243 208..430 100 -> Plus
arm_X 20288614..20288834 431..651 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:57:55 Download gff for RH67410.complete
Subject Subject Range Query Range Percent Splice Strand
X 20402086..20402308 208..430 100 -> Plus
X 20402679..20402899 431..651 100   Plus
X 20401814..20402020 1..207 99 -> Plus

RH67410.hyp Sequence

Translation from 2 to 514

> RH67410.hyp
LFTRRAKMMQCSRMTTTLKMTNLLLAVACAAVLMGSATADEEEGSMTVDE
VVELIEPFGDACTPKPSRENIVEMVLNKEDAKHETKCFRHCMLEQFELMP
EDQLQYNEDKTVDMINMMFPDREDDGRRIVKTCNEELKAEQDKCEAAHGI
AMCMLREMRSSGFKIPEIKE*

RH67410.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19b-PA 163 CG1670-PA 1..163 8..170 852 100 Plus

RH67410.pep Sequence

Translation from 23 to 514

> RH67410.pep
MMQCSRMTTTLKMTNLLLAVACAAVLMGSATADEEEGSMTVDEVVELIEP
FGDACTPKPSRENIVEMVLNKEDAKHETKCFRHCMLEQFELMPEDQLQYN
EDKTVDMINMMFPDREDDGRRIVKTCNEELKAEQDKCEAAHGIAMCMLRE
MRSSGFKIPEIKE*

RH67410.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19416-PA 156 GF19416-PA 9..156 16..163 645 80.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19288-PA 163 GG19288-PA 1..163 1..163 714 82.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17929-PA 161 GH17929-PA 14..161 15..163 426 53.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19b-PA 163 CG1670-PA 1..163 1..163 852 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16308-PA 157 GI16308-PA 28..157 34..163 438 59.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26841-PA 158 GL26841-PA 7..158 13..163 543 67.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp19b-PA 158 GA14089-PA 7..158 13..163 547 68.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23030-PA 163 GM23030-PA 1..163 1..163 804 92.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17489-PA 1505 GD17489-PA 1431..1505 89..163 400 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp19b-PA 164 GJ15644-PA 2..164 1..163 457 54 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20146-PA 167 GK20146-PA 1..166 1..163 511 60.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17880-PA 163 GE17880-PA 1..163 1..163 702 85.9 Plus