Clone RH67738 Report

Search the DGRC for RH67738

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:677
Well:38
Vector:pFlc-1
Associated Gene/TranscriptCG30373-RA
Protein status:RH67738.pep: gold
Sequenced Size:623

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30373 2002-08-25 Blastp of sequenced clone
CG30373 2003-01-01 Sim4 clustering to Release 3
CG30373 2008-04-29 Release 5.5 accounting
CG30373 2008-08-15 Release 5.9 accounting
CG30373 2008-12-18 5.12 accounting

Clone Sequence Records

RH67738.complete Sequence

623 bp (623 high quality bases) assembled on 2002-08-25

GenBank Submission: BT001862

> RH67738.complete
GATCTCTAAATCGTCAGCTGTTTAACCAATTTTGTTATGAAATTTGCTTG
AGTTTCCCATCGAAAATGCTGCGTTTGCTTACAAAAACAAGGGTGCTGCG
CCAACTGATGCCAGCGACAGGCGCCACTCCACCTGCATCCCGCTTCTATG
CGAAGAACCAAGGAGCAGCCAGCCAAAAATCGGATGACGACATGGTCAGC
GATGAGCCCATCAAGTTTTTCGGCAGCCAGGCGGCCACTTGGCGCGCCAA
GGACACCCGCAGTGGTGGCAGCGACGAGACCCTTTGGTACCAACCCTACG
TAATCTCCGCCAGCCTGGCCATCTTCCTCCTGTACTTCTGTGCGCTGCGC
GAGGAGAGCGACATCGATCTCCGGTTGGAGGGCAACTTGTACGAGCATGT
CAGTGGTCTGGAGGAGGTGCAGCTGACTGTCAACTACAGGTACAACAAGG
AACACGGACTGGACACCAAGGAGCAGGAGAGACGGCTCAGGGAACTGGGC
GTTGATCTGGGCCAGTTGGATGCCAAGTTGGCCGCCCAGTAGTCGTAGGG
TTGGTTTGTTGTACGTTTTTGTTTCGTTAAGTGAAATTAAACATTTTTAA
TAACTAGAAAAAAAAAAAAAAAA

RH67738.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG30373-RA 683 CG30373-RA 1..608 2..609 3040 100 Plus
Rs1.b 2609 Rs1.b 1..65 164..100 325 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4051519..4052026 607..100 2540 100 Minus
chr2R 21145070 chr2R 4052087..4052185 100..2 495 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8163998..8164507 609..100 2550 100 Minus
2R 25286936 2R 8164568..8164666 100..2 495 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8165197..8165706 609..100 2550 100 Minus
2R 25260384 2R 8165767..8165865 100..2 495 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:13:22 has no hits.

RH67738.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:13:59 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4051519..4052025 101..607 100 <- Minus
chr2R 4052087..4052185 1..100 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:48 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
CG30373-RA 1..477 66..542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:32:16 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
CG30373-RA 1..477 66..542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:08:06 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
CG30373-RA 1..477 66..542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:16:07 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
CG30373-RA 1..477 66..542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:00:05 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
CG30373-RA 1..477 66..542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:37:23 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
CG30373-RA 1..606 2..607 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:32:16 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
CG30373-RA 1..606 2..607 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:08:06 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
CG30373-RA 4..610 1..607 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:16:07 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
CG30373-RA 1..606 2..607 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:00:05 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
CG30373-RA 4..610 1..607 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:13:59 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8164000..8164506 101..607 100 <- Minus
2R 8164568..8164666 1..100 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:13:59 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8164000..8164506 101..607 100 <- Minus
2R 8164568..8164666 1..100 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:13:59 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8164000..8164506 101..607 100 <- Minus
2R 8164568..8164666 1..100 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:08:06 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4051505..4052011 101..607 100 <- Minus
arm_2R 4052073..4052171 1..100 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:53:03 Download gff for RH67738.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8165199..8165705 101..607 100 <- Minus
2R 8165767..8165865 1..100 99   Minus

RH67738.hyp Sequence

Translation from 2 to 541

> RH67738.hyp
SLNRQLFNQFCYEICLSFPSKMLRLLTKTRVLRQLMPATGATPPASRFYA
KNQGAASQKSDDDMVSDEPIKFFGSQAATWRAKDTRSGGSDETLWYQPYV
ISASLAIFLLYFCALREESDIDLRLEGNLYEHVSGLEEVQLTVNYRYNKE
HGLDTKEQERRLRELGVDLGQLDAKLAAQ*

RH67738.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG30373-PB 158 CG30373-PB 1..158 22..179 808 100 Plus
CG30373-PA 158 CG30373-PA 1..158 22..179 808 100 Plus

RH67738.pep Sequence

Translation from 65 to 541

> RH67738.pep
MLRLLTKTRVLRQLMPATGATPPASRFYAKNQGAASQKSDDDMVSDEPIK
FFGSQAATWRAKDTRSGGSDETLWYQPYVISASLAIFLLYFCALREESDI
DLRLEGNLYEHVSGLEEVQLTVNYRYNKEHGLDTKEQERRLRELGVDLGQ
LDAKLAAQ*

RH67738.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11204-PA 157 GF11204-PA 1..157 1..158 658 76.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10667-PA 157 GG10667-PA 1..157 1..158 767 91.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20829-PA 156 GH20829-PA 1..156 1..158 617 73.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG30373-PB 158 CG30373-PB 1..158 1..158 808 100 Plus
CG30373-PA 158 CG30373-PA 1..158 1..158 808 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20929-PA 157 GI20929-PA 1..156 1..156 637 75.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10884-PA 155 GL10884-PA 1..154 1..157 609 73.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15796-PA 155 GA15796-PA 1..154 1..157 613 73.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20712-PA 158 GM20712-PA 1..158 1..158 826 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10179-PA 158 GD10179-PA 1..158 1..158 830 98.7 Plus
Dsim\GD15290-PA 144 GD15290-PA 1..144 15..158 764 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20656-PA 158 GJ20656-PA 1..158 1..158 614 73.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19096-PA 159 GK19096-PA 1..159 1..158 594 70.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23234-PA 156 GE23234-PA 1..156 1..158 779 93 Plus