Clone RH67809 Report

Search the DGRC for RH67809

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:678
Well:9
Vector:pFlc-1
Associated Gene/TranscriptCG11368-RA
Protein status:RH67809.pep: gold
Preliminary Size:367
Sequenced Size:378

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11368 2002-01-01 Sim4 clustering to Release 2
CG11368 2002-04-26 Blastp of sequenced clone
CG11368 2003-01-01 Sim4 clustering to Release 3
CG11368 2008-04-29 Release 5.5 accounting
CG11368 2008-08-15 Release 5.9 accounting
CG11368 2008-12-18 5.12 accounting

Clone Sequence Records

RH67809.complete Sequence

378 bp (378 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113619

> RH67809.complete
GAACAGTTAACATCTGGACATTTGGCAAGATGCATCTGAACCTGAAATAT
TTCATTGGTCTGCTACTGGTGCTGCTTTGCAGCTCTTTTGCGGTGGCCTA
TCCCCAGGGGCCTGGGTGTGGTCCACCACCAAGTGGAACACCTCCGTCGG
GACCGCGACCATCGGGTCCACCACCTGGAGGTCGCTGCGGACCACCACCA
TCGACCACGGCTGCATCTACCGGTTAAATTTGTCCACCTCTGCGATTCCC
GACTTCAATTTCCCTCATAAGGCTTACTGAAATGTCACCTAGAAAATCCT
TTTGTTAAGTCCCTTTTTTTTTTGACAAACAAATTAAATGAAAAGTATAT
GTATGTGTGTATAAAAAAAAAAAAAAAA

RH67809.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG11368-RA 577 CG11368-RA 197..559 2..364 1785 99.4 Plus
CG11368.a 787 CG11368.a 407..769 2..364 1785 99.4 Plus
CG11368.c 970 CG11368.c 590..952 2..364 1785 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7344304..7344574 92..362 1325 99.3 Plus
chrX 22417052 chrX 7344140..7344232 2..94 465 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7452373..7452645 92..364 1335 99.3 Plus
X 23542271 X 7452209..7452301 2..94 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7460471..7460743 92..364 1335 99.2 Plus
X 23527363 X 7460307..7460399 2..94 465 100 Plus
Blast to na_te.dros performed 2019-03-16 13:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy9 5349 gypsy9 GYPSY9 5349bp 686..771 276..359 146 66.7 Plus

RH67809.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:29:26 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7344139..7344230 1..92 98 -> Plus
chrX 7344305..7344574 93..362 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:49 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 1..198 30..227 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:35 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 1..198 30..227 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:54 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 1..198 30..227 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:01 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 1..198 30..227 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:36 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 1..198 30..227 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:33:22 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 2..362 2..362 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:34 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 2..362 2..362 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:54 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 1..361 2..362 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:01 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 2..362 2..362 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:36 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 1..361 2..362 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:26 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
X 7452208..7452299 1..92 98 -> Plus
X 7452374..7452643 93..362 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:26 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
X 7452208..7452299 1..92 98 -> Plus
X 7452374..7452643 93..362 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:26 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
X 7452208..7452299 1..92 98 -> Plus
X 7452374..7452643 93..362 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:54 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7346407..7346676 93..362 99   Plus
arm_X 7346241..7346332 1..92 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:40 Download gff for RH67809.complete
Subject Subject Range Query Range Percent Splice Strand
X 7460472..7460741 93..362 99   Plus
X 7460306..7460397 1..92 98 -> Plus

RH67809.hyp Sequence

Translation from 2 to 226

> RH67809.hyp
TVNIWTFGKMHLNLKYFIGLLLVLLCSSFAVAYPQGPGCGPPPSGTPPSG
PRPSGPPPGGRCGPPPSTTAASTG*

RH67809.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG11368-PA 65 CG11368-PA 1..65 10..74 367 100 Plus

RH67809.pep Sequence

Translation from 29 to 226

> RH67809.pep
MHLNLKYFIGLLLVLLCSSFAVAYPQGPGCGPPPSGTPPSGPRPSGPPPG
GRCGPPPSTTAASTG*

RH67809.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19648-PA 65 GG19648-PA 1..65 1..65 124 96.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11368-PA 65 CG11368-PA 1..65 1..65 367 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16849-PA 65 GD16849-PA 1..65 1..65 300 98.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15723-PA 65 GE15723-PA 1..65 1..65 295 96.9 Plus