RH67809.complete Sequence
378 bp (378 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113619
> RH67809.complete
GAACAGTTAACATCTGGACATTTGGCAAGATGCATCTGAACCTGAAATAT
TTCATTGGTCTGCTACTGGTGCTGCTTTGCAGCTCTTTTGCGGTGGCCTA
TCCCCAGGGGCCTGGGTGTGGTCCACCACCAAGTGGAACACCTCCGTCGG
GACCGCGACCATCGGGTCCACCACCTGGAGGTCGCTGCGGACCACCACCA
TCGACCACGGCTGCATCTACCGGTTAAATTTGTCCACCTCTGCGATTCCC
GACTTCAATTTCCCTCATAAGGCTTACTGAAATGTCACCTAGAAAATCCT
TTTGTTAAGTCCCTTTTTTTTTTGACAAACAAATTAAATGAAAAGTATAT
GTATGTGTGTATAAAAAAAAAAAAAAAA
RH67809.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:10:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11368-RA | 577 | CG11368-RA | 197..559 | 2..364 | 1785 | 99.4 | Plus |
CG11368.a | 787 | CG11368.a | 407..769 | 2..364 | 1785 | 99.4 | Plus |
CG11368.c | 970 | CG11368.c | 590..952 | 2..364 | 1785 | 99.4 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:28:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 7344304..7344574 | 92..362 | 1325 | 99.3 | Plus |
chrX | 22417052 | chrX | 7344140..7344232 | 2..94 | 465 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:28:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7452373..7452645 | 92..364 | 1335 | 99.3 | Plus |
X | 23542271 | X | 7452209..7452301 | 2..94 | 465 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 7460471..7460743 | 92..364 | 1335 | 99.2 | Plus |
X | 23527363 | X | 7460307..7460399 | 2..94 | 465 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 13:28:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy9 | 5349 | gypsy9 GYPSY9 5349bp | 686..771 | 276..359 | 146 | 66.7 | Plus |
RH67809.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:29:26 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 7344139..7344230 | 1..92 | 98 | -> | Plus |
chrX | 7344305..7344574 | 93..362 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:49 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11368-RA | 1..198 | 30..227 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:35 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11368-RA | 1..198 | 30..227 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:54 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11368-RA | 1..198 | 30..227 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:01 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11368-RA | 1..198 | 30..227 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:36 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11368-RA | 1..198 | 30..227 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:33:22 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11368-RA | 2..362 | 2..362 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:34 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11368-RA | 2..362 | 2..362 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:54 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11368-RA | 1..361 | 2..362 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:01 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11368-RA | 2..362 | 2..362 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:36 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11368-RA | 1..361 | 2..362 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:26 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7452208..7452299 | 1..92 | 98 | -> | Plus |
X | 7452374..7452643 | 93..362 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:26 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7452208..7452299 | 1..92 | 98 | -> | Plus |
X | 7452374..7452643 | 93..362 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:26 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7452208..7452299 | 1..92 | 98 | -> | Plus |
X | 7452374..7452643 | 93..362 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:54 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7346407..7346676 | 93..362 | 99 | | Plus |
arm_X | 7346241..7346332 | 1..92 | 98 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:40 Download gff for
RH67809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7460472..7460741 | 93..362 | 99 | | Plus |
X | 7460306..7460397 | 1..92 | 98 | -> | Plus |
RH67809.hyp Sequence
Translation from 2 to 226
> RH67809.hyp
TVNIWTFGKMHLNLKYFIGLLLVLLCSSFAVAYPQGPGCGPPPSGTPPSG
PRPSGPPPGGRCGPPPSTTAASTG*
RH67809.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:02:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11368-PA | 65 | CG11368-PA | 1..65 | 10..74 | 367 | 100 | Plus |
RH67809.pep Sequence
Translation from 29 to 226
> RH67809.pep
MHLNLKYFIGLLLVLLCSSFAVAYPQGPGCGPPPSGTPPSGPRPSGPPPG
GRCGPPPSTTAASTG*
RH67809.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:39:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG19648-PA | 65 | GG19648-PA | 1..65 | 1..65 | 124 | 96.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11368-PA | 65 | CG11368-PA | 1..65 | 1..65 | 367 | 100 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:39:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD16849-PA | 65 | GD16849-PA | 1..65 | 1..65 | 300 | 98.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:39:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE15723-PA | 65 | GE15723-PA | 1..65 | 1..65 | 295 | 96.9 | Plus |