Clone RH67853 Report

Search the DGRC for RH67853

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:678
Well:53
Vector:pFlc-1
Associated Gene/TranscriptDh31-RC
Protein status:RH67853.pep: gold
Sequenced Size:1310

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Dh31-RC 2010-01-15 Manual selection by Sue Celniker

Clone Sequence Records

RH67853.complete Sequence

1310 bp assembled on 2010-02-12

GenBank Submission: BT120329.1

> RH67853.complete
GACTGCGTTTCAGTCTCAAAGCGGTGCAGTCAGCAGCAGTAACGGTTAAT
ATTTGGAATCGATCTAAACCAATCGAACTTTGATCGCAAATAAAGCGAAA
GTGTTGTGTGCATTTGTGAAAAAGGGAGACAGCCGCACAAAGATGACAAA
CCGATGCGCTTGCTTCGCCTTGGCCTTCCTCCTCTTCTGCCTCTTGGCCA
TCTCGAGCATCGAGGCAGCTCCGATGCCCAGGTACCAATCCAATGGAGGA
TACGGTGGCGCTGGCTATAACGAACTGGAGGAGGTGCCCGACGACCTACT
CATGGAACTGATGACTCGCTTTGGACGCACCATCATACGGGCTCGAAACG
ATCTGGAGAATTCCAAACGAACCGTGGACTTTGGCTTGGCCCGGGGATAT
TCGGGTACCCAGGAGGCGAAACATCGCATGGGTCTGGCTGCAGCCAACTT
TGCCGGAGGACCCGGTCGGAGGCGACGATCCGAGACCGATGTCTAAGGCG
TCTGGATGAGACCGGGCTGCGAATCCTGTGAACGTTGAGGACGAACGTCA
ACTTTTTCCACCTAAACTTGGCCCATACTTTGATACTTTCCTAGATCTTT
CATTTGCATTACGTTTAATTGTTTGTTATTCATTGTACATAAATATTTAT
TACGGAAATGTCCTCATGCAATTCATCAAAATTTTTTTTCCCTTCAAGAG
TTATACGAAAATAATATTCAACAGATATCGAAATTATATATACCAAAGGC
GAATAAAAGCGTTAAACTGTTGCTCCGAAAGAAAAAATGTTGAAAACAAT
TTATGCAAATTTTCATCCCAGATTTAACTCAGTGATAATTGCTCGTTTTA
ACCCGAAAATATGGAAGAAAGGTAAAGAGAGAAGGGAGAAATTTAAATAA
ATATATCCTAAATATATATTCAAGTGTAAGCATAATCGCGCAAAAAATCT
TTAACTAGGTATGTCTTACATAAACTAACAAAAATTTAAAAAAAAAGATC
TACACAAATATACATACTTATATGCTAACAACACACTTTTGGCCCCCAAA
ATGAAGCCAACAAAAACAAAAAAACCCCAACGAAACTGAAAGTTTATTTT
ATCAATAGCCAACTTGGTCTCACGCGACTTTTAAGTATTGTAAATATAAA
TTATTAAAGCACACGTACAACTAATGCGATACAAATATATTACGGAATTC
TACTTGCATATATATTTAATAATTATTGTGTCTATGCTGCAAACATATAT
CTTAACGTGAGTCGGACACGATCAAATAAAAGTCTACATTTTGAGAAAAA
AAAAAAAAAA

RH67853.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dh31-RC 1311 Dh31-RC 20..1311 4..1295 6445 99.9 Plus
Dh31-RA 1295 Dh31-RA 7..1295 4..1295 6375 99.6 Plus
Dh31.a 799 Dh31.a 4..357 4..360 1715 99.1 Plus
Dh31.a 799 Dh31.a 522..799 361..638 1390 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8490785..8491719 1295..361 4660 99.9 Minus
chr2L 23010047 chr2L 8491884..8492009 360..235 630 100 Minus
chr2L 23010047 chr2L 8492661..8492770 234..125 535 99.1 Minus
chr2L 23010047 chr2L 8505542..8505614 126..54 365 100 Minus
chr2L 23010047 chr2L 8505701..8505750 53..4 250 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8491866..8492802 1297..361 4670 99.9 Minus
2L 23513712 2L 8492967..8493092 360..235 630 100 Minus
2L 23513712 2L 8493744..8493853 234..125 550 100 Minus
2L 23513712 2L 8506634..8506706 126..54 365 100 Minus
2L 23513712 2L 8506793..8506842 53..4 250 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8491866..8492802 1297..361 4670 99.8 Minus
2L 23513712 2L 8492967..8493092 360..235 630 100 Minus
2L 23513712 2L 8493744..8493853 234..125 550 100 Minus
2L 23513712 2L 8506634..8506706 126..54 365 100 Minus
2L 23513712 2L 8506793..8506842 53..4 250 100 Minus
Blast to na_te.dros performed 2019-03-15 17:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dkoe\Gandalf 979 Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). 726..966 1136..903 128 55.1 Minus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 709..848 887..1034 127 60.3 Plus
TAHRE 10463 TAHRE OSV 10463bp 7343..7411 968..1038 115 69.9 Plus

RH67853.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:13:31 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8490785..8491719 361..1295 99 <- Minus
chr2L 8491884..8492009 235..360 100 <- Minus
chr2L 8492661..8492769 126..234 99 <- Minus
chr2L 8505543..8505614 54..125 100 <- Minus
chr2L 8505701..8505753 1..53 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:22:49 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 1..354 143..496 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:27:06 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 1..354 143..496 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:28:29 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 1..354 143..496 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:16 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 1..354 143..496 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:22:49 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 1..1295 2..1295 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:27:06 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 1..1295 2..1295 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:28:29 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 1..1295 2..1295 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:16 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 1..1295 2..1295 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:31 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8491868..8492802 361..1295 99 <- Minus
2L 8492967..8493092 235..360 100 <- Minus
2L 8493744..8493852 126..234 100 <- Minus
2L 8506635..8506706 54..125 100 <- Minus
2L 8506793..8506845 1..53 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:31 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8491868..8492802 361..1295 99 <- Minus
2L 8492967..8493092 235..360 100 <- Minus
2L 8493744..8493852 126..234 100 <- Minus
2L 8506635..8506706 54..125 100 <- Minus
2L 8506793..8506845 1..53 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:31 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8491868..8492802 361..1295 99 <- Minus
2L 8492967..8493092 235..360 100 <- Minus
2L 8493744..8493852 126..234 100 <- Minus
2L 8506635..8506706 54..125 100 <- Minus
2L 8506793..8506845 1..53 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:28:29 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8491868..8492802 361..1295 99 <- Minus
arm_2L 8492967..8493092 235..360 100 <- Minus
arm_2L 8493744..8493852 126..234 100 <- Minus
arm_2L 8506635..8506706 54..125 100 <- Minus
arm_2L 8506793..8506845 1..53 96   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:30 Download gff for RH67853.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8491868..8492802 361..1295 99 <- Minus
2L 8492967..8493092 235..360 100 <- Minus
2L 8493744..8493852 126..234 100 <- Minus
2L 8506635..8506706 54..125 100 <- Minus
2L 8506793..8506845 1..53 96   Minus

RH67853.hyp Sequence

Translation from 142 to 495

> RH67853.hyp
MTNRCACFALAFLLFCLLAISSIEAAPMPRYQSNGGYGGAGYNELEEVPD
DLLMELMTRFGRTIIRARNDLENSKRTVDFGLARGYSGTQEAKHRMGLAA
ANFAGGPGRRRRSETDV*

RH67853.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dh31-PC 117 CG13094-PC 1..117 1..117 607 100 Plus
Dh31-PA 116 CG13094-PA 1..116 1..117 582 98.3 Plus

RH67853.pep Sequence

Translation from 142 to 495

> RH67853.pep
MTNRCACFALAFLLFCLLAISSIEAAPMPRYQSNGGYGGAGYNELEEVPD
DLLMELMTRFGRTIIRARNDLENSKRTVDFGLARGYSGTQEAKHRMGLAA
ANFAGGPGRRRRSETDV*

RH67853.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14370-PA 116 GF14370-PA 1..116 1..117 435 92.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24068-PA 116 GG24068-PA 1..116 1..117 587 98.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10771-PA 115 GH10771-PA 1..115 1..117 445 85.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dh31-PC 117 CG13094-PC 1..117 1..117 607 100 Plus
Dh31-PA 116 CG13094-PA 1..116 1..117 582 98.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17634-PA 116 GI17634-PA 2..116 1..117 503 85.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25648-PA 119 GL25648-PA 1..119 1..117 489 87.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12042-PA 119 GA12042-PA 1..119 1..117 489 87.5 Plus
Dpse\GA22214-PA 119 GA22214-PA 1..119 1..117 487 86.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12880-PA 116 GM12880-PA 1..116 1..117 587 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22397-PA 116 GD22397-PA 1..116 1..117 587 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18199-PA 115 GJ18199-PA 1..115 1..117 487 82.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24837-PA 120 GK24837-PA 1..120 1..117 472 86.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10938-PA 116 GE10938-PA 1..116 1..117 587 98.3 Plus