Clone RH67886 Report

Search the DGRC for RH67886

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:678
Well:86
Vector:pFlc-1
Associated Gene/TranscriptCG14823-RB
Protein status:RH67886.pep: gold
Sequenced Size:959

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14823 2004-01-09 Blastp of sequenced clone
CG14823 2008-04-29 Release 5.5 accounting
CG14823 2008-08-15 Release 5.9 accounting
CG14823 2008-12-18 5.12 accounting

Clone Sequence Records

RH67886.complete Sequence

959 bp (959 high quality bases) assembled on 2004-01-09

GenBank Submission: BT011340

> RH67886.complete
GAGTCGGTTTGCGATAGCAAAGGGAGAAGCCAGCTCGCCATGGAGCCCAC
ATGCAGCAGCAGTGTGGCGGAATTGGCCAAATACAGTGAGGATGATGTGG
AAACGGATGAGTCCAAGGTGGTGGAGCATCAGGAATATGCCGAAGCGCTG
TCAATGTCCGGGGAAAGTCGTAAGCGGAAACGATGGACTCGAAGGTCCTG
CTGCACTCGCCAAGTCCTGAGTACGGGCGCCATTTTCATCGCCCTTCTGC
TCATCATCGGCGCCATTTACATGCACTTAAGACAGAAGCATCATCTGGGC
CGACTGCACATCAATCTCAAGGATCGGGGGCAAGTGGAGGTCCTGGAGGA
GGACTTTCCCATGGTCACCGCTGCGGGAGTGGCTGACTGATTAGAATTGC
CATTAGATGAACCAGCAGATTTCAACGTTTCGAAATTATAGCGATAATAA
ATAAAAGCTTGTATTTATTACACAACAACTATGCAACGCATGCCCAGACC
TCGACGATAACAACATTCCAGCCGCCTCCGACATCCTCCCCAGAGCCCAG
TGCCAAGTGCCTGGACTGCATGGCCACCACTGCCACGGATAATATTCCGG
CAATCTGCAGGCACCGAGGACGACCAGAGGAGCCGTGCGGCATTTATCGC
ATCTCCCACGTCTACTGGCAGGACGCACTCCGGATAATTGACCCGGACGA
CTCACTCGCCCGGGACTACGGAAGATGCGTGGTGGATGTCCAGTGCGCCG
AGCGTATTGTGCGTAGCTATGTGCAGCGATATGGTGGCGAGGATTGCAAT
GGAGACGGACGGATCGAGTGTCGGGATCATGTGAGGCTGCACATGAGAGG
ACCCGGCGGCTGCCGCAGGCAGGAGCCACTGGGGAGCCTGTCTGAGAGGA
GATTGGAAAACTGCTTGAAATACAGGGGGATTACTTAAAACCGAAAAAAA
AAAAAAAAA

RH67886.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG14823-RB 1103 CG14823-RB 162..1103 2..943 4710 100 Plus
CG14823-RD 1133 CG14823-RD 547..1109 382..944 2815 100 Plus
CG14823-RA 1127 CG14823-RA 649..1103 490..944 2275 100 Plus
CG14823-RD 1133 CG14823-RD 33..417 2..386 1910 99.7 Plus
CG14823-RA 1127 CG14823-RA 268..648 2..382 1905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7058566..7058950 2..386 1850 98.7 Plus
chr3L 24539361 chr3L 7059775..7059999 490..714 1110 99.6 Plus
chr3L 24539361 chr3L 7060223..7060452 714..943 1105 98.7 Plus
chr3L 24539361 chr3L 7059080..7059187 382..489 540 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7066346..7066730 2..386 1910 99.7 Plus
3L 28110227 3L 7068003..7068233 714..944 1155 100 Plus
3L 28110227 3L 7067555..7067779 490..714 1125 100 Plus
3L 28110227 3L 7066860..7066967 382..489 540 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7059446..7059830 2..386 1910 99.7 Plus
3L 28103327 3L 7061103..7061333 714..944 1155 100 Plus
3L 28103327 3L 7060655..7060879 490..714 1125 100 Plus
3L 28103327 3L 7059960..7060067 382..489 540 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:38:28 has no hits.

RH67886.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:39:33 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7059081..7059187 383..489 100 -> Plus
chr3L 7058565..7058946 1..382 98 -> Plus
chr3L 7059775..7059999 490..714 99 -> Plus
chr3L 7060224..7060452 715..943 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:52:53 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..343 40..382 100 == Plus
CG14823-RA 344..792 490..938 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:41:34 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..343 40..382 100 == Plus
CG14823-RA 344..792 490..938 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:16:54 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..343 40..382 100 == Plus
CG14823-RA 344..792 490..938 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:30:25 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..343 40..382 100 == Plus
CG14823-RA 344..792 490..938 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:25:19 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..343 40..382 100 == Plus
CG14823-RA 344..792 490..938 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:50:57 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RD 32..413 1..382 99 -> Plus
CG14823-RD 548..1108 383..943 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:41:34 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RB 32..974 1..943 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:16:54 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RB 32..974 1..943 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:30:25 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RD 32..413 1..382 99 -> Plus
CG14823-RD 548..1108 383..943 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:25:19 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RB 32..974 1..943 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:33 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7068004..7068232 715..943 100   Plus
3L 7066345..7066726 1..382 99 -> Plus
3L 7066861..7066967 383..489 100 -> Plus
3L 7067555..7067779 490..714 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:33 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7068004..7068232 715..943 100   Plus
3L 7066345..7066726 1..382 99 -> Plus
3L 7066861..7066967 383..489 100 -> Plus
3L 7067555..7067779 490..714 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:33 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7068004..7068232 715..943 100   Plus
3L 7066345..7066726 1..382 99 -> Plus
3L 7066861..7066967 383..489 100 -> Plus
3L 7067555..7067779 490..714 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:16:54 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7059445..7059826 1..382 99 -> Plus
arm_3L 7059961..7060067 383..489 100 -> Plus
arm_3L 7060655..7060879 490..714 100 -> Plus
arm_3L 7061104..7061332 715..943 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:02:53 Download gff for RH67886.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7059445..7059826 1..382 99 -> Plus
3L 7059961..7060067 383..489 100 -> Plus
3L 7060655..7060879 490..714 100 -> Plus
3L 7061104..7061332 715..943 100   Plus

RH67886.pep Sequence

Translation from 39 to 389

> RH67886.pep
MEPTCSSSVAELAKYSEDDVETDESKVVEHQEYAEALSMSGESRKRKRWT
RRSCCTRQVLSTGAIFIALLLIIGAIYMHLRQKHHLGRLHINLKDRGQVE
VLEEDFPMVTAAGVAD*

RH67886.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25005-PA 264 GF25005-PA 7..122 6..115 268 55.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14400-PA 264 GG14400-PA 1..105 1..106 454 84.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15386-PA 226 GH15386-PA 37..102 54..115 145 47 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14823-PB 116 CG14823-PB 1..116 1..116 592 100 Plus
CG14823-PD 129 CG14823-PD 1..116 1..116 584 98.3 Plus
CG14823-PA 263 CG14823-PA 1..114 1..114 582 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12991-PA 230 GI12991-PA 40..103 53..115 135 46.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25021-PA 254 GL25021-PA 1..118 1..114 241 51.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13274-PA 254 GA13274-PA 1..117 1..115 238 51.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14814-PA 263 GM14814-PA 1..114 1..114 578 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13989-PA 263 GD13989-PA 1..114 1..114 590 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13134-PA 225 GJ13134-PA 30..98 49..115 165 54.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16648-PA 274 GK16648-PA 1..113 1..98 201 43.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21589-PA 262 GE21589-PA 1..105 1..106 430 90.6 Plus

RH67886.hyp Sequence

Translation from 569 to 937

> RH67886.hyp
MATTATDNIPAICRHRGRPEEPCGIYRISHVYWQDALRIIDPDDSLARDY
GRCVVDVQCAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRR
QEPLGSLSERRLENCLKYRGIT*

RH67886.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14823-PA 263 CG14823-PA 142..263 1..122 675 100 Plus
CG6426-PA 161 CG6426-PA 57..149 23..116 162 34.4 Plus
CG6421-PA 161 CG6421-PA 47..153 8..117 160 33.3 Plus
CG6429-PA 159 CG6429-PA 54..151 23..117 155 35.4 Plus
CG6435-PA 163 CG6435-PA 41..144 8..117 149 36.6 Plus