RH68384.complete Sequence
498 bp assembled on 2010-03-02
GenBank Submission: BT122039.1
> RH68384.complete
GATAGTAAGAACTTTAGGTGAACAAGACAACGGAGACGGAACGATGCGTA
TTTACCACCTGAATCTATTAGTGCTAAGTGCCGGCCTACTGGTCCTGCTG
GCCCAGTCGGGGACCACGGCCCCCCAGGCGGATGAGGATGTACAGCAACT
GACTCTGGCGGATGTAAATCAGGCGGAGGAGCAGCAGGAGATGCCGGCTG
TTCGCCTGGCCAGACAATTTGGATTCGGCCGTGAAGGATTCGGCAGAGGA
CGCGGCGGATTCGGCGGATTTGGCGGAAGGCGAGGCGGCGGTGGATTCCG
GAGACCCGGTTTCGGTGGCGGTGGATTCGGCGGATTCTACCCACCGCCAC
CGCCCTTCTTCGGCGGCCCCTTTTACGGCTAGGTGTTCTTAATTTAATGT
GCATATATATATGTGATACGATCAGACCAGGATTAGCTACTAATATATCA
ACACGAGCTGCTGCTCTCATTATCTTACCAAGAAAAAAAAAAAAAAAA
RH68384.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:36:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9759-RA | 494 | CG9759-RA | 7..487 | 2..482 | 2405 | 100 | Plus |
CG9759.a | 590 | CG9759.a | 20..500 | 2..482 | 2405 | 100 | Plus |
CG9759.b | 1259 | CG9759.b | 20..500 | 2..482 | 2405 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:22:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 9433675..9434155 | 482..2 | 2390 | 99.8 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:22:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13608760..13609240 | 482..2 | 2405 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 13349591..13350071 | 482..2 | 2405 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 17:22:26 has no hits.
RH68384.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:23:08 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 9433675..9434155 | 1..482 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-03 09:17:10 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9759-RB | 1..339 | 44..382 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:36 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9759-RA | 1..339 | 44..382 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:35 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9759-RA | 1..339 | 44..382 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:35:12 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9759-RA | 1..339 | 44..382 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-03 09:17:10 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9759-RA | 6..487 | 1..482 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:36 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9759-RA | 6..487 | 1..482 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:35 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9759-RA | 6..487 | 1..482 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:35:12 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9759-RA | 6..487 | 1..482 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:23:08 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13608760..13609240 | 1..482 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:23:08 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13608760..13609240 | 1..482 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:23:08 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13608760..13609240 | 1..482 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:35 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 9434482..9434962 | 1..482 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:32:08 Download gff for
RH68384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13349591..13350071 | 1..482 | 99 | | Minus |
RH68384.hyp Sequence
Translation from 0 to 381
> RH68384.hyp
IVRTLGEQDNGDGTMRIYHLNLLVLSAGLLVLLAQSGTTAPQADEDVQQL
TLADVNQAEEQQEMPAVRLARQFGFGREGFGRGRGGFGGFGGRRGGGGFR
RPGFGGGGFGGFYPPPPPFFGGPFYG*
RH68384.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9759-PB | 112 | CG9759-PB | 1..112 | 15..126 | 604 | 100 | Plus |
CG9759-PC | 112 | CG9759-PC | 1..112 | 15..126 | 604 | 100 | Plus |
CG9759-PA | 112 | CG9759-PA | 1..112 | 15..126 | 604 | 100 | Plus |
CG17738-PA | 110 | CG17738-PA | 8..110 | 28..126 | 141 | 43.4 | Plus |
RH68384.pep Sequence
Translation from 1 to 381
> RH68384.pep
IVRTLGEQDNGDGTMRIYHLNLLVLSAGLLVLLAQSGTTAPQADEDVQQL
TLADVNQAEEQQEMPAVRLARQFGFGREGFGRGRGGFGGFGGRRGGGGFR
RPGFGGGGFGGFYPPPPPFFGGPFYG*
RH68384.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:14:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17373-PA | 144 | GF17373-PA | 1..87 | 15..78 | 180 | 59.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:14:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG17039-PA | 108 | GG17039-PA | 1..58 | 15..72 | 278 | 94.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9759-PB | 112 | CG9759-PB | 1..112 | 15..126 | 604 | 100 | Plus |
CG9759-PC | 112 | CG9759-PC | 1..112 | 15..126 | 604 | 100 | Plus |
CG9759-PA | 112 | CG9759-PA | 1..112 | 15..126 | 604 | 100 | Plus |
CG17738-PA | 110 | CG17738-PA | 8..110 | 28..126 | 141 | 43.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:14:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25924-PA | 112 | GM25924-PA | 1..112 | 15..126 | 266 | 95.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:14:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD20489-PA | 112 | GD20489-PA | 1..112 | 15..126 | 522 | 97.3 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:14:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ23114-PA | 112 | GJ23114-PA | 1..59 | 15..74 | 145 | 56.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:14:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK13338-PA | 118 | GK13338-PA | 1..55 | 15..72 | 179 | 69 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:14:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE24431-PA | 117 | GE24431-PA | 1..70 | 15..84 | 247 | 91.4 | Plus |