Clone RH68384 Report

Search the DGRC for RH68384

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:683
Well:84
Vector:pFlc-1
Associated Gene/TranscriptCG9759-RA
Protein status:RH68384.pep: gold
Sequenced Size:498

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9759-RA 2009-01-21 est gleaning
CG9759 2010-02-18 Manual selection by Sue Celniker

Clone Sequence Records

RH68384.complete Sequence

498 bp assembled on 2010-03-02

GenBank Submission: BT122039.1

> RH68384.complete
GATAGTAAGAACTTTAGGTGAACAAGACAACGGAGACGGAACGATGCGTA
TTTACCACCTGAATCTATTAGTGCTAAGTGCCGGCCTACTGGTCCTGCTG
GCCCAGTCGGGGACCACGGCCCCCCAGGCGGATGAGGATGTACAGCAACT
GACTCTGGCGGATGTAAATCAGGCGGAGGAGCAGCAGGAGATGCCGGCTG
TTCGCCTGGCCAGACAATTTGGATTCGGCCGTGAAGGATTCGGCAGAGGA
CGCGGCGGATTCGGCGGATTTGGCGGAAGGCGAGGCGGCGGTGGATTCCG
GAGACCCGGTTTCGGTGGCGGTGGATTCGGCGGATTCTACCCACCGCCAC
CGCCCTTCTTCGGCGGCCCCTTTTACGGCTAGGTGTTCTTAATTTAATGT
GCATATATATATGTGATACGATCAGACCAGGATTAGCTACTAATATATCA
ACACGAGCTGCTGCTCTCATTATCTTACCAAGAAAAAAAAAAAAAAAA

RH68384.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG9759-RA 494 CG9759-RA 7..487 2..482 2405 100 Plus
CG9759.a 590 CG9759.a 20..500 2..482 2405 100 Plus
CG9759.b 1259 CG9759.b 20..500 2..482 2405 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9433675..9434155 482..2 2390 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13608760..13609240 482..2 2405 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13349591..13350071 482..2 2405 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:22:26 has no hits.

RH68384.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:23:08 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9433675..9434155 1..482 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-03 09:17:10 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
CG9759-RB 1..339 44..382 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:36 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
CG9759-RA 1..339 44..382 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:35 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
CG9759-RA 1..339 44..382 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:35:12 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
CG9759-RA 1..339 44..382 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-03 09:17:10 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
CG9759-RA 6..487 1..482 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:36 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
CG9759-RA 6..487 1..482 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:35 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
CG9759-RA 6..487 1..482 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:35:12 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
CG9759-RA 6..487 1..482 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:23:08 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13608760..13609240 1..482 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:23:08 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13608760..13609240 1..482 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:23:08 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13608760..13609240 1..482 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:35 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9434482..9434962 1..482 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:32:08 Download gff for RH68384.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13349591..13350071 1..482 99   Minus

RH68384.hyp Sequence

Translation from 0 to 381

> RH68384.hyp
IVRTLGEQDNGDGTMRIYHLNLLVLSAGLLVLLAQSGTTAPQADEDVQQL
TLADVNQAEEQQEMPAVRLARQFGFGREGFGRGRGGFGGFGGRRGGGGFR
RPGFGGGGFGGFYPPPPPFFGGPFYG*

RH68384.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9759-PB 112 CG9759-PB 1..112 15..126 604 100 Plus
CG9759-PC 112 CG9759-PC 1..112 15..126 604 100 Plus
CG9759-PA 112 CG9759-PA 1..112 15..126 604 100 Plus
CG17738-PA 110 CG17738-PA 8..110 28..126 141 43.4 Plus

RH68384.pep Sequence

Translation from 1 to 381

> RH68384.pep
IVRTLGEQDNGDGTMRIYHLNLLVLSAGLLVLLAQSGTTAPQADEDVQQL
TLADVNQAEEQQEMPAVRLARQFGFGREGFGRGRGGFGGFGGRRGGGGFR
RPGFGGGGFGGFYPPPPPFFGGPFYG*

RH68384.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17373-PA 144 GF17373-PA 1..87 15..78 180 59.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17039-PA 108 GG17039-PA 1..58 15..72 278 94.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG9759-PB 112 CG9759-PB 1..112 15..126 604 100 Plus
CG9759-PC 112 CG9759-PC 1..112 15..126 604 100 Plus
CG9759-PA 112 CG9759-PA 1..112 15..126 604 100 Plus
CG17738-PA 110 CG17738-PA 8..110 28..126 141 43.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25924-PA 112 GM25924-PA 1..112 15..126 266 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20489-PA 112 GD20489-PA 1..112 15..126 522 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23114-PA 112 GJ23114-PA 1..59 15..74 145 56.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13338-PA 118 GK13338-PA 1..55 15..72 179 69 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24431-PA 117 GE24431-PA 1..70 15..84 247 91.4 Plus