Clone RH68439 Report

Search the DGRC for RH68439

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:684
Well:39
Vector:pFlc-1
Associated Gene/TranscriptCG4019-RA
Protein status:RH68439.pep: gold
Preliminary Size:1089
Sequenced Size:1101

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4019 2002-01-01 Sim4 clustering to Release 2
CG4019 2003-08-11 Blastp of sequenced clone
CG4019 2008-04-29 Release 5.5 accounting
CG4019 2008-08-15 Release 5.9 accounting
CG4019 2008-12-18 5.12 accounting

Clone Sequence Records

RH68439.complete Sequence

1101 bp (1101 high quality bases) assembled on 2003-08-11

GenBank Submission: BT010205

> RH68439.complete
GGCAGACGATCGCGCGTATTTAGCTGGAGGCCTTTTCCACACTCAATAGC
AAACAAACGATCGATCGGAACGCAGTTGCTGTAAGGTCTTCAAAATGAAG
GGATCGACGCTGGACAAAATCTCCGCCTTCCTCGGCGAGCTCATCGGCAC
CGGCATCCTGGTCTTCCTGGGCTGCATGGGTTGCGTGAAGACGGACCTCT
TTCCCAACAACCATCTGCAGATTGTGCTGAACTTCGGCTTCGCCGTCCTC
ATCGCCATCCAGTGCTTTGGCTGCGTCTCCGGTGCCCATCTGAATCCCGC
CGTGACCGTGGCCGCCTACATCTACGAGATGGTCACCCTGCGCATGGCAT
TTGCCTACTTCGCCGCCCAGATGCTGGGCGCCTTCATCGGCTACGGCCTG
CTCATGGTCCTGCTTCCCTCGCCCACACTTACGGTGGGCGCTGGGCTCTG
CGTGACCTTGCCCCACACCAGCGTAACCACGGGCCAGGCCCTCGGCATCG
AGTTCGTAATCACCTCCATCCTGGTCATCGTCTGCTGCGGAGTGTGGGAT
CCGCGCAACTCCAAGTTCCATGACTCCGTGGGCATTCGATTTGGCCTGGC
CATCGCCTGTCTCGCCTGCGCTGCCGGTCCCTTCACCGGCGGCAGCATGA
ACCCGGCCAGGTCGTTCGCCCCCGCCCTGTGGAACAAGCACTTCGAGAGC
AACTGGATCTACTGGCTGGCCCCGCTGAGCTCCTCCGCCATCACCGCCTA
CGCCTACAAGGTCGTCTTCCGCCGCGAGGTGGTTGAGGCGGAGATCACCT
CCAATGAGAAGCTGCGGCAACTGGAGGACGTCCAGCTGTCGTAAGGCCAA
AGACATTGCTGTAGGAAAAGCCCTAACTAATTTAGTTAATATCTAAGATG
CCGAATTTTAAAATAATGCATTCGTTGTACGCTAATGTTAGCAGTGTCTT
CACAAAGTGGTTCGAACGTTTCAAAAGGCGAACCAAGTGCACACACTTAC
ATAAGCCCTTGAAACGATAAACGTCTTGGTGAAAACACTAATTGCCTTCA
GAAATAAAGAACATCGAGATTTTTAATCTAAAACCAAAAAAAAAAAAAAA
A

RH68439.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG4019.c 1517 CG4019.c 352..1444 2..1094 5420 99.7 Plus
CG4019-RA 1191 CG4019-RA 26..1118 2..1094 5420 99.7 Plus
CG4019-RB 1346 CG4019-RB 254..1273 75..1094 5070 99.8 Plus
CG4019-RB 1346 CG4019-RB 1..48 28..75 240 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19494360..19494913 626..73 2755 99.8 Minus
chr2R 21145070 chr2R 19493822..19494280 1084..626 2250 99.3 Minus
chr2R 21145070 chr2R 19490872..19491047 402..227 400 81.8 Minus
chr2R 21145070 chr2R 19500899..19500972 75..2 355 98.6 Minus
chr2R 21145070 chr2R 19492603..19492688 317..232 220 83.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23608131..23608684 626..73 2770 100 Minus
2R 25286936 2R 23607583..23608051 1094..626 2315 99.6 Minus
2R 25286936 2R 23604625..23604800 402..227 400 81.8 Minus
2R 25286936 2R 23614673..23614746 75..2 355 98.6 Minus
2R 25286936 2R 23606358..23606443 317..232 205 82.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23609330..23609883 626..73 2770 100 Minus
2R 25260384 2R 23608782..23609250 1094..626 2315 99.5 Minus
2R 25260384 2R 23605824..23605999 402..227 400 81.8 Minus
2R 25260384 2R 23615872..23615945 75..2 355 98.6 Minus
2R 25260384 2R 23607557..23607642 317..232 205 82.5 Minus
Blast to na_te.dros performed on 2019-03-15 20:38:36 has no hits.

RH68439.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:39:38 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19493821..19494280 626..1085 99 <- Minus
chr2R 19494361..19494910 76..625 99 <- Minus
chr2R 19500899..19500972 1..75 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:01 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 17..786 75..844 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:48:27 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 17..786 75..844 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:17:00 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RF 123..894 73..844 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:15:51 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 17..786 75..844 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:25:21 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RF 123..894 73..844 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:12:27 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RA 1..1084 2..1085 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:48:26 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RA 1..1084 2..1085 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:17:00 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RA 1..1048 38..1085 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:15:51 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RA 1..1084 2..1085 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:25:21 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RA 1..1048 38..1085 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:38 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23607592..23608051 626..1085 99 <- Minus
2R 23608132..23608681 76..625 100 <- Minus
2R 23614673..23614746 1..75 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:38 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23607592..23608051 626..1085 99 <- Minus
2R 23608132..23608681 76..625 100 <- Minus
2R 23614673..23614746 1..75 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:39:38 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23607592..23608051 626..1085 99 <- Minus
2R 23608132..23608681 76..625 100 <- Minus
2R 23614673..23614746 1..75 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:17:00 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19495115..19495574 626..1085 99 <- Minus
arm_2R 19495655..19496204 76..625 100 <- Minus
arm_2R 19502196..19502269 1..75 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:49:45 Download gff for RH68439.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23608809..23609268 626..1085 99 <- Minus
2R 23609349..23609898 76..625 100 <- Minus
2R 23615890..23615963 1..75 97   Minus

RH68439.hyp Sequence

Translation from 94 to 843

> RH68439.hyp
MKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFA
VLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGY
GLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGV
WDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHF
ESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKLRQLEDVQLS*

RH68439.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG4019-PB 249 CG4019-PB 1..249 1..249 1295 100 Plus
CG4019-PD 249 CG4019-PD 1..249 1..249 1295 100 Plus
CG4019-PA 249 CG4019-PA 1..249 1..249 1295 100 Plus
CG4019-PC 261 CG4019-PC 13..261 1..249 1295 100 Plus
CG4019-PE 286 CG4019-PE 38..286 1..249 1295 100 Plus

RH68439.pep Sequence

Translation from 94 to 843

> RH68439.pep
MKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFA
VLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGY
GLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGV
WDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHF
ESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKLRQLEDVQLS*

RH68439.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11830-PA 244 GF11830-PA 1..244 1..244 1047 77.5 Plus
Dana\GF11832-PA 266 GF11832-PA 18..262 6..244 705 53.5 Plus
Dana\GF11831-PA 272 GF11831-PA 29..269 9..246 647 52.3 Plus
Dana\GF13068-PA 242 GF13068-PA 12..198 13..199 310 35.6 Plus
Dana\GF12394-PA 245 GF12394-PA 26..244 12..238 307 35.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20010-PA 261 GG20010-PA 13..261 1..249 1213 96 Plus
Dere\GG20012-PA 294 GG20012-PA 42..277 1..233 731 55.5 Plus
Dere\GG20011-PA 271 GG20011-PA 19..267 1..246 629 47.8 Plus
Dere\GG22871-PA 238 GG22871-PA 14..234 15..234 315 33 Plus
Dere\GG22646-PA 245 GG22646-PA 26..244 12..238 278 33.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21219-PA 246 GH21219-PA 1..246 1..249 1079 81.5 Plus
Dgri\GH21221-PA 259 GH21221-PA 14..257 1..239 749 57.8 Plus
Dgri\GH21220-PA 267 GH21220-PA 19..267 1..244 629 48.4 Plus
Dgri\GH20503-PA 247 GH20503-PA 26..246 12..238 289 36.4 Plus
Dgri\GH20663-PA 250 GH20663-PA 12..241 13..237 271 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Eglp4-PF 297 CG4019-PF 49..297 1..249 1295 100 Plus
Eglp4-PE 286 CG4019-PE 38..286 1..249 1295 100 Plus
Eglp4-PC 261 CG4019-PC 13..261 1..249 1295 100 Plus
Eglp4-PB 249 CG4019-PB 1..249 1..249 1295 100 Plus
Eglp4-PD 249 CG4019-PD 1..249 1..249 1295 100 Plus
Eglp4-PA 249 CG4019-PA 1..249 1..249 1295 100 Plus
Eglp2-PA 265 CG17664-PA 18..249 6..234 712 55.6 Plus
Eglp2-PC 290 CG17664-PC 43..274 6..234 712 55.6 Plus
Eglp3-PB 270 CG17662-PB 19..267 1..246 634 48.2 Plus
Eglp1-PA 238 CG5398-PA 14..196 15..196 347 37.7 Plus
Drip-PF 278 CG9023-PF 27..254 13..248 305 33.5 Plus
Drip-PG 233 CG9023-PG 27..232 13..226 302 35.5 Plus
Drip-PE 239 CG9023-PE 21..226 13..226 302 35.5 Plus
Drip-PD 242 CG9023-PD 24..229 13..226 302 35.5 Plus
Drip-PC 243 CG9023-PC 25..230 13..226 302 35.5 Plus
Drip-PB 245 CG9023-PB 27..232 13..226 302 35.5 Plus
Drip-PA 245 CG9023-PA 27..232 13..226 302 35.5 Plus
Prip-PD 259 CG7777-PD 13..250 1..245 288 31 Plus
Prip-PA 264 CG7777-PA 13..250 1..245 288 31 Plus
Prip-PB 268 CG7777-PB 13..250 1..245 288 31 Plus
Prip-PC 270 CG7777-PC 13..250 1..245 288 31 Plus
bib-PA 696 CG4722-PA 61..277 5..225 212 27.4 Plus
bib-PB 737 CG4722-PB 61..277 5..225 212 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20504-PA 249 GI20504-PA 1..249 1..249 1039 82.3 Plus
Dmoj\GI20505-PA 274 GI20505-PA 24..274 1..246 640 49 Plus
Dmoj\GI20506-PA 247 GI20506-PA 6..234 2..227 575 52 Plus
Dmoj\GI21049-PA 247 GI21049-PA 26..246 12..238 300 38.2 Plus
Dmoj\GI19026-PA 242 GI19026-PA 14..241 15..241 298 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17596-PA 249 GL17596-PA 1..249 1..249 1149 85.1 Plus
Dper\GL17598-PA 266 GL17598-PA 14..264 1..244 727 54.6 Plus
Dper\GL17597-PA 272 GL17597-PA 27..271 7..248 654 50.6 Plus
Dper\GL21483-PA 245 GL21483-PA 3..199 6..199 322 37.7 Plus
Dper\GL18952-PA 691 GL18952-PA 98..285 41..233 182 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17871-PA 249 GA17871-PA 1..249 1..249 1147 85.1 Plus
Dpse\GA24838-PA 266 GA24838-PA 14..264 1..244 730 54.6 Plus
Dpse\GA24837-PA 273 GA24837-PA 28..272 7..248 652 50.6 Plus
Dpse\GA26287-PA 245 GA26287-PA 3..199 6..199 325 37.7 Plus
Dpse\GA24443-PA 244 GA24443-PA 26..240 12..233 317 36.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15522-PA 261 GM15522-PA 13..261 1..249 1265 96.4 Plus
Dsec\GM15524-PA 265 GM15524-PA 13..249 1..234 713 53.2 Plus
Dsec\GM15523-PA 274 GM15523-PA 19..271 1..246 611 47.4 Plus
Dsec\GM20426-PA 245 GM20426-PA 26..244 12..238 288 34.4 Plus
Dsec\GM21291-PA 264 GM21291-PA 13..250 1..245 246 31 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25026-PA 261 GD25026-PA 13..261 1..249 1270 96.8 Plus
Dsim\GD25028-PA 265 GD25028-PA 13..249 1..234 710 53.2 Plus
Dsim\GD25027-PA 265 GD25027-PA 19..262 1..246 614 49.2 Plus
Dsim\GD10798-PA 264 GD10798-PA 13..250 1..245 246 31 Plus
Dsim\GD23647-PA 674 GD23647-PA 100..288 41..244 184 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22355-PA 252 GJ22355-PA 1..222 1..222 954 80.6 Plus
Dvir\GJ22357-PA 247 GJ22357-PA 7..246 6..240 731 57.3 Plus
Dvir\GJ22356-PA 274 GJ22356-PA 142..274 116..246 331 47 Plus
Dvir\GJ19992-PA 248 GJ19992-PA 12..202 13..202 301 35.1 Plus
Dvir\GJ21971-PA 305 GJ21971-PA 84..304 12..238 283 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23174-PA 249 GK23174-PA 1..249 1..249 1064 83.5 Plus
Dwil\GK23178-PA 270 GK23178-PA 16..269 1..248 801 57.9 Plus
Dwil\GK23177-PA 262 GK23177-PA 15..257 7..246 664 51.4 Plus
Dwil\GK23175-PA 238 GK23175-PA 12..235 1..228 456 42.1 Plus
Dwil\GK21884-PA 245 GK21884-PA 26..244 12..238 302 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11546-PA 261 GE11546-PA 13..261 1..249 1211 96 Plus
Dyak\GE11549-PA 265 GE11549-PA 13..249 1..234 721 54 Plus
Dyak\GE11548-PA 271 GE11548-PA 19..267 1..246 621 47.4 Plus
Dyak\GE14309-PA 238 GE14309-PA 14..202 15..202 341 38.1 Plus
Dyak\GE13520-PA 245 GE13520-PA 26..244 12..238 291 34.4 Plus