Clone RH68724 Report

Search the DGRC for RH68724

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:687
Well:24
Vector:pFlc-1
Associated Gene/TranscriptCG32695-RA
Protein status:RH68724.pep: gold
Preliminary Size:615
Sequenced Size:401

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32695 2001-12-17 Blastp of sequenced clone
CG15246 2002-01-01 Sim4 clustering to Release 2
CG32695 2003-01-01 Sim4 clustering to Release 3
CG32695 2008-04-29 Release 5.5 accounting
CG32695 2008-08-15 Release 5.9 accounting
CG32695 2008-12-18 5.12 accounting

Clone Sequence Records

RH68724.complete Sequence

401 bp (401 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071764

> RH68724.complete
GGTGCGACTGAAACCCTTGGAACGAGATGCGATCTGTACTGCCGTCGGTG
GGATTTCTGCTGCTCCTGGCTCTGCTGCTCGGCTCCTCGTGCACTGAATC
CGGCAGGGTGATCTACTTCAATCAACTGAACACCACCCAAGCCCTAGAGG
CGGCCAAAAACAACAGCGATGCCCTGGGCAAGGGAATGCTCCTTGATGTG
CGCGGAAATCGCTGCCCACGCGGATTCGTTCGCGATCATCATGGGCGTTG
CAGAAGGCGTGTCTAAAACTGGACTCTCCCACTGAGCAAAGTTAAATTTA
AATGCGTGTTTATTTTTAAGTCTGTTTGCCTTGCGCAGATTAAAACTGTC
TACGGATCTTGTAACAACGATATGACAGATAACAGCAAAAAAAAAAAAAA
A

RH68724.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32695-RA 680 CG32695-RA 149..536 2..389 1940 100 Plus
CG32695.a 1233 CG32695.a 63..450 2..389 1940 100 Plus
CG32695.b 1588 CG32695.b 63..450 2..389 1940 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9765416..9765671 257..2 1280 100 Minus
chrX 22417052 chrX 9765224..9765353 386..257 635 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9873734..9873989 257..2 1280 100 Minus
X 23542271 X 9873539..9873671 389..257 665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9881832..9882087 257..2 1280 100 Minus
X 23527363 X 9881637..9881769 389..257 665 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:58:36 has no hits.

RH68724.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:59:30 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9765224..9765352 258..386 99 <- Minus
chrX 9765416..9765671 1..257 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:08 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 1..240 27..266 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:05 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 1..240 27..266 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:40 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 1..240 27..266 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:08:32 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 1..240 27..266 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:16:07 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 1..240 27..266 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:45 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 1..385 2..386 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:05 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 1..385 2..386 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:40 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 1..385 2..386 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:08:32 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 1..385 2..386 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:16:07 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 1..385 2..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:30 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
X 9873542..9873670 258..386 100 <- Minus
X 9873734..9873989 1..257 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:30 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
X 9873542..9873670 258..386 100 <- Minus
X 9873734..9873989 1..257 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:30 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
X 9873542..9873670 258..386 100 <- Minus
X 9873734..9873989 1..257 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:40 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9767575..9767703 258..386 100 <- Minus
arm_X 9767767..9768022 1..257 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:52 Download gff for RH68724.complete
Subject Subject Range Query Range Percent Splice Strand
X 9881640..9881768 258..386 100 <- Minus
X 9881832..9882087 1..257 99   Minus

RH68724.pep Sequence

Translation from 26 to 265

> RH68724.pep
MRSVLPSVGFLLLLALLLGSSCTESGRVIYFNQLNTTQALEAAKNNSDAL
GKGMLLDVRGNRCPRGFVRDHHGRCRRRV*

RH68724.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19165-PA 74 GF19165-PA 13..73 19..79 239 73.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18958-PA 78 GG18958-PA 1..78 1..79 284 82.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12916-PA 85 GH12916-PA 20..85 14..79 177 53 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG32695-PC 79 CG32695-PC 1..79 1..79 407 100 Plus
CG32695-PB 79 CG32695-PB 1..79 1..79 407 100 Plus
CG32695-PA 79 CG32695-PA 1..79 1..79 407 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14619-PA 84 GI14619-PA 16..84 11..79 150 44.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16603-PA 89 GL16603-PA 27..79 25..77 184 64.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22303-PA 81 GA22303-PA 27..81 25..79 183 63.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11344-PA 79 GM11344-PA 1..79 1..79 347 94.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24555-PA 79 GD24555-PA 1..79 1..79 347 94.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19433-PA 97 GJ19433-PA 22..84 12..77 162 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15430-PA 82 GE15430-PA 1..82 1..79 301 79.3 Plus

RH68724.hyp Sequence

Translation from 26 to 265

> RH68724.hyp
MRSVLPSVGFLLLLALLLGSSCTESGRVIYFNQLNTTQALEAAKNNSDAL
GKGMLLDVRGNRCPRGFVRDHHGRCRRRV*

RH68724.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32695-PC 79 CG32695-PC 1..79 1..79 407 100 Plus
CG32695-PB 79 CG32695-PB 1..79 1..79 407 100 Plus
CG32695-PA 79 CG32695-PA 1..79 1..79 407 100 Plus