BDGP Sequence Production Resources |
Search the DGRC for RH68952
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 689 |
Well: | 52 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Obp57c-RA |
Protein status: | RH68952.pep: gold |
Preliminary Size: | 548 |
Sequenced Size: | 600 |
Gene | Date | Evidence |
---|---|---|
CG13421 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13421 | 2002-01-09 | Blastp of sequenced clone |
CG13421 | 2003-01-01 | Sim4 clustering to Release 3 |
Obp57c | 2008-04-29 | Release 5.5 accounting |
Obp57c | 2008-08-15 | Release 5.9 accounting |
Obp57c | 2008-12-18 | 5.12 accounting |
600 bp (600 high quality bases) assembled on 2002-01-09
GenBank Submission: AY075565
> RH68952.complete GAAAATTCAGAACCGCCTTTCTGCGAGTAACAGTTTATCGTGAGGTGCTA CTGTGCTAGGAAAACCCATGTCCATATTTATCTTGAAACAGATTCTGCGA ATCGTTAGATAATGCTTAAGCTATGGCTAATATGTATCTTGACTGTCAGC GTGGTCTCCATACAGAGTCTCTCACTTCTGGAGGAAACCAATTACGTGTC AGATTGCCTGGCCAGCAATAACATCAGCCAGGCTGAATTCCAGGAACTCA TCGATCGCAACAGCTCCGAAGAGGATGACCTCGAGAATACCGACAGAAGA TACAAATGCTTCATCCATTGCCTAGCGGAGAAGGGAAATCTTTTGGATAC CAATGGCTATTTGGATGTGGATAAAATTGATCAAATTGAGCCCGTGAGCG ATGAACTGCGAGAGATACTCTACGATTGCAAGAAAATCTACGATGAGGAA GAAGATCATTGCGAATATGCGTTTAAGATGGTGACTTGTCTAACTGAAAG CTTCGAGCAGAGCGATGAGGTCACCGAAGCGGGTAAAAATACAAACAAAT TAAACGAATAATCGGTCTAAAACTGGTCAAGCAACAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 16390358..16390522 | 1..165 | 96 | -> | Plus |
chr2R | 16390586..16391005 | 166..585 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp57c-RB | 1..450 | 112..561 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp57c-RB | 1..450 | 112..561 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp57c-RA | 1..450 | 112..561 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp57c-RB | 1..450 | 112..561 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp57c-RA | 1..450 | 112..561 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp57c-RA | 2..585 | 2..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp57c-RA | 2..585 | 2..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp57c-RA | 1..557 | 29..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp57c-RA | 2..585 | 2..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp57c-RA | 1..557 | 29..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20503556..20503720 | 1..165 | 99 | -> | Plus |
2R | 20503783..20504202 | 166..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20503556..20503720 | 1..165 | 99 | -> | Plus |
2R | 20503783..20504202 | 166..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20503556..20503720 | 1..165 | 99 | -> | Plus |
2R | 20503783..20504202 | 166..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 16391061..16391225 | 1..165 | 99 | -> | Plus |
arm_2R | 16391288..16391707 | 166..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20504982..20505401 | 166..585 | 100 | Plus | |
2R | 20504755..20504919 | 1..165 | 99 | -> | Plus |
Translation from 111 to 560
> RH68952.pep MLKLWLICILTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQELIDRN SSEEDDLENTDRRYKCFIHCLAEKGNLLDTNGYLDVDKIDQIEPVSDELR EILYDCKKIYDEEEDHCEYAFKMVTCLTESFEQSDEVTEAGKNTNKLNE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22034-PA | 149 | GG22034-PA | 1..149 | 1..149 | 678 | 87.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20839-PA | 122 | GH20839-PA | 8..118 | 31..142 | 188 | 33 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Obp57c-PA | 149 | CG13421-PA | 1..149 | 1..149 | 777 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20942-PA | 108 | GI20942-PA | 5..107 | 29..132 | 246 | 42.3 | Plus |
Dmoj\GI18673-PA | 118 | GI18673-PA | 7..118 | 32..143 | 167 | 31 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17664-PA | 148 | GL17664-PA | 1..148 | 1..149 | 320 | 44.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\Obp57c-PA | 148 | GA12274-PA | 1..148 | 1..149 | 323 | 44.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22017-PA | 149 | GM22017-PA | 1..149 | 1..149 | 710 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\Obp57c-PA | 149 | GD11516-PA | 1..149 | 1..149 | 723 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Obp57c-PA | 129 | GJ20665-PA | 5..116 | 17..131 | 196 | 33.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19302-PA | 76 | GK19302-PA | 2..76 | 63..136 | 183 | 48 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12114-PA | 146 | GE12114-PA | 1..146 | 1..149 | 588 | 79.9 | Plus |
Translation from 111 to 560
> RH68952.hyp MLKLWLICILTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQELIDRN SSEEDDLENTDRRYKCFIHCLAEKGNLLDTNGYLDVDKIDQIEPVSDELR EILYDCKKIYDEEEDHCEYAFKMVTCLTESFEQSDEVTEAGKNTNKLNE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Obp57c-PA | 149 | CG13421-PA | 1..149 | 1..149 | 777 | 100 | Plus |