Clone RH68952 Report

Search the DGRC for RH68952

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:689
Well:52
Vector:pFlc-1
Associated Gene/TranscriptObp57c-RA
Protein status:RH68952.pep: gold
Preliminary Size:548
Sequenced Size:600

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13421 2002-01-01 Sim4 clustering to Release 2
CG13421 2002-01-09 Blastp of sequenced clone
CG13421 2003-01-01 Sim4 clustering to Release 3
Obp57c 2008-04-29 Release 5.5 accounting
Obp57c 2008-08-15 Release 5.9 accounting
Obp57c 2008-12-18 5.12 accounting

Clone Sequence Records

RH68952.complete Sequence

600 bp (600 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075565

> RH68952.complete
GAAAATTCAGAACCGCCTTTCTGCGAGTAACAGTTTATCGTGAGGTGCTA
CTGTGCTAGGAAAACCCATGTCCATATTTATCTTGAAACAGATTCTGCGA
ATCGTTAGATAATGCTTAAGCTATGGCTAATATGTATCTTGACTGTCAGC
GTGGTCTCCATACAGAGTCTCTCACTTCTGGAGGAAACCAATTACGTGTC
AGATTGCCTGGCCAGCAATAACATCAGCCAGGCTGAATTCCAGGAACTCA
TCGATCGCAACAGCTCCGAAGAGGATGACCTCGAGAATACCGACAGAAGA
TACAAATGCTTCATCCATTGCCTAGCGGAGAAGGGAAATCTTTTGGATAC
CAATGGCTATTTGGATGTGGATAAAATTGATCAAATTGAGCCCGTGAGCG
ATGAACTGCGAGAGATACTCTACGATTGCAAGAAAATCTACGATGAGGAA
GAAGATCATTGCGAATATGCGTTTAAGATGGTGACTTGTCTAACTGAAAG
CTTCGAGCAGAGCGATGAGGTCACCGAAGCGGGTAAAAATACAAACAAAT
TAAACGAATAATCGGTCTAAAACTGGTCAAGCAACAAAAAAAAAAAAAAA

RH68952.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Obp57c-RA 609 Obp57c-RA 2..585 2..585 2920 100 Plus
Obp57c-RB 1116 Obp57c-RB 1..527 59..585 2635 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16390584..16391005 164..585 2020 98.6 Plus
chr2R 21145070 chr2R 16390359..16390522 2..165 760 97.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20503781..20504202 164..585 2110 100 Plus
2R 25286936 2R 20503557..20503720 2..165 820 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20504980..20505401 164..585 2110 100 Plus
2R 25260384 2R 20504756..20504919 2..165 820 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:48:34 has no hits.

RH68952.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:49:21 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16390358..16390522 1..165 96 -> Plus
chr2R 16390586..16391005 166..585 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:11 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57c-RB 1..450 112..561 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:50:30 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57c-RB 1..450 112..561 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:48:05 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57c-RA 1..450 112..561 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:05 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57c-RB 1..450 112..561 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:58 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57c-RA 1..450 112..561 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:14:20 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57c-RA 2..585 2..585 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:50:30 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57c-RA 2..585 2..585 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:48:05 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57c-RA 1..557 29..585 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:05 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57c-RA 2..585 2..585 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:58 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57c-RA 1..557 29..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:21 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20503556..20503720 1..165 99 -> Plus
2R 20503783..20504202 166..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:21 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20503556..20503720 1..165 99 -> Plus
2R 20503783..20504202 166..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:21 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20503556..20503720 1..165 99 -> Plus
2R 20503783..20504202 166..585 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:48:05 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16391061..16391225 1..165 99 -> Plus
arm_2R 16391288..16391707 166..585 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:51:09 Download gff for RH68952.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20504982..20505401 166..585 100   Plus
2R 20504755..20504919 1..165 99 -> Plus

RH68952.pep Sequence

Translation from 111 to 560

> RH68952.pep
MLKLWLICILTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQELIDRN
SSEEDDLENTDRRYKCFIHCLAEKGNLLDTNGYLDVDKIDQIEPVSDELR
EILYDCKKIYDEEEDHCEYAFKMVTCLTESFEQSDEVTEAGKNTNKLNE*

RH68952.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22034-PA 149 GG22034-PA 1..149 1..149 678 87.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20839-PA 122 GH20839-PA 8..118 31..142 188 33 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
Obp57c-PA 149 CG13421-PA 1..149 1..149 777 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20942-PA 108 GI20942-PA 5..107 29..132 246 42.3 Plus
Dmoj\GI18673-PA 118 GI18673-PA 7..118 32..143 167 31 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17664-PA 148 GL17664-PA 1..148 1..149 320 44.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp57c-PA 148 GA12274-PA 1..148 1..149 323 44.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22017-PA 149 GM22017-PA 1..149 1..149 710 93.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp57c-PA 149 GD11516-PA 1..149 1..149 723 94.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp57c-PA 129 GJ20665-PA 5..116 17..131 196 33.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19302-PA 76 GK19302-PA 2..76 63..136 183 48 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12114-PA 146 GE12114-PA 1..146 1..149 588 79.9 Plus

RH68952.hyp Sequence

Translation from 111 to 560

> RH68952.hyp
MLKLWLICILTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQELIDRN
SSEEDDLENTDRRYKCFIHCLAEKGNLLDTNGYLDVDKIDQIEPVSDELR
EILYDCKKIYDEEEDHCEYAFKMVTCLTESFEQSDEVTEAGKNTNKLNE*

RH68952.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Obp57c-PA 149 CG13421-PA 1..149 1..149 777 100 Plus