Clone RH69586 Report

Search the DGRC for RH69586

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:695
Well:86
Vector:pFlc-1
Associated Gene/TranscriptPrx2540-2-RA
Protein status:RH69586.pep: gold
Preliminary Size:727
Sequenced Size:870

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11765 2002-01-01 Sim4 clustering to Release 2
CG11765 2002-03-28 Blastp of sequenced clone
CG11765 2003-01-01 Sim4 clustering to Release 3
Prx2540-2 2008-04-29 Release 5.5 accounting
Prx2540-2 2008-08-15 Release 5.9 accounting
Prx2540-2 2008-12-18 5.12 accounting

Clone Sequence Records

RH69586.complete Sequence

870 bp (870 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094953

> RH69586.complete
GATTCAGTAAGCAACAAGTGTGCGAGCTAAAAGCAGCTACCAGTTGAGCA
ACTAAGTTTTTTTGAAACTAATAATCAAACAGCAAGATGCGTTTGGGACA
GACCGTACCTAACTTCGAGGCCGACACAACCAAGGGGCCCATTAAATTCC
ACGAGTGGCAGGGCAACTCCTGGGTGGTGCTCTTCTCTCACCCCGCCGAC
TTTACTCCCGTCTGCACCACTGAGCTGGGCAGGATTGCGGTGCACCAGCC
GGAGTTTGCCAAGCGGAACACCAAGTGCCTGGCACATTCCGTTGACGCAT
TGAACTCGCACGTGGACTGGGTGAACGACATCAAGAGCTATTGCCTGGAC
ATTCCCGGGGACTTCCCCTACCCGATCATCGCCGACCCTACTCGCGACCT
GGCCGTCAGCCTGGGCATGCTCGACGAGGAGCAGAAGAAGGATCCCGAGG
TGGGCAAGACCATCCGCGCCCTGTTCATCATCAGTCCGGACCATAAGGTG
CGCCTCTCCATGTTCTACCCCATGTCCACTGGTCGCAACGTTGACGAGAT
TCTGAGGACCATTGACTCCCTCCAGCTGACTGATCGCCTCAAGGTGGTGG
CCACTCCCGCCAACTGGACCCCTGGCACTAAGGTCATGATCCTGCCCACT
GTCACCGATGAAGAGGCTCATAAACTCTTCCCCAAGGGATTTGATAAGGT
ATCCATGCCGTCTGGAGTAAACTACGTCCGCACCACTGACAACTACTGAC
ACAAAACCGTTCCCCATTTGTGATCCATTCAATAATGTGCCGTATTTCCT
GACATATACTATATACTATGTGCAGTTCATTTATTTAATAAAAAATTATT
TTAACAAAAAAAAAAAAAAA

RH69586.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Prx2540-2-RA 968 Prx2540-2-RA 103..960 2..859 4290 100 Plus
Prx2540-1.a 905 Prx2540-1.a 3..701 2..700 3495 100 Plus
Prx2540-1-RA 854 Prx2540-1-RA 73..755 63..745 3265 98.5 Plus
Prx2540-1.a 905 Prx2540-1.a 696..812 629..745 540 97.4 Plus
Prx2540-1-RA 854 Prx2540-1-RA 3..56 2..55 225 94.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6306410..6306784 170..544 1875 100 Plus
chr2R 21145070 chr2R 6312137..6312511 170..544 1800 98.7 Plus
chr2R 21145070 chr2R 6314796..6315170 544..170 1800 98.7 Minus
chr2R 21145070 chr2R 6306987..6307221 621..855 1175 100 Plus
chr2R 21145070 chr2R 6306179..6306347 2..169 795 99.4 Plus
chr2R 21145070 chr2R 6311898..6312074 2..169 620 92.7 Plus
chr2R 21145070 chr2R 6315233..6315409 169..2 620 92.7 Minus
chr2R 21145070 chr2R 6312714..6312838 621..745 580 97.6 Plus
chr2R 21145070 chr2R 6314469..6314593 745..621 535 95.2 Minus
chr2R 21145070 chr2R 6306848..6306923 545..620 380 100 Plus
chr2R 21145070 chr2R 6312575..6312650 545..620 365 98.7 Plus
chr2R 21145070 chr2R 6314657..6314732 620..545 365 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10418950..10419324 170..544 1875 100 Plus
2R 25286936 2R 10424677..10425051 170..544 1800 98.7 Plus
2R 25286936 2R 10427300..10427674 544..170 1800 98.7 Minus
2R 25286936 2R 10419527..10419765 621..859 1195 100 Plus
2R 25286936 2R 10418720..10418887 2..169 840 100 Plus
2R 25286936 2R 10424438..10424614 2..169 620 92.7 Plus
2R 25286936 2R 10427737..10427913 169..2 620 92.7 Minus
2R 25286936 2R 10425254..10425378 621..745 580 97.6 Plus
2R 25286936 2R 10426973..10427097 745..621 535 95.2 Minus
2R 25286936 2R 10419388..10419463 545..620 380 100 Plus
2R 25286936 2R 10425115..10425190 545..620 365 98.7 Plus
2R 25286936 2R 10427161..10427236 620..545 365 98.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10420149..10420523 170..544 1875 100 Plus
2R 25260384 2R 10425876..10426250 170..544 1800 98.6 Plus
2R 25260384 2R 10428499..10428873 544..170 1800 98.6 Minus
2R 25260384 2R 10420726..10420964 621..859 1195 100 Plus
2R 25260384 2R 10419919..10420086 2..169 840 100 Plus
2R 25260384 2R 10426453..10426577 621..745 580 97.6 Plus
2R 25260384 2R 10428172..10428296 745..621 535 95.2 Minus
2R 25260384 2R 10425707..10425813 63..169 520 99 Plus
2R 25260384 2R 10428936..10429042 169..63 520 99 Minus
2R 25260384 2R 10420587..10420662 545..620 380 100 Plus
2R 25260384 2R 10426314..10426389 545..620 365 98.6 Plus
2R 25260384 2R 10428360..10428435 620..545 365 98.6 Minus
2R 25260384 2R 10425637..10425690 2..55 225 94.4 Plus
2R 25260384 2R 10429059..10429112 55..2 225 94.4 Minus
Blast to na_te.dros performed on 2019-03-15 23:19:28 has no hits.

RH69586.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:20:34 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6306177..6306347 1..169 98 -> Plus
chr2R 6306410..6306784 170..544 100 -> Plus
chr2R 6306848..6306923 545..620 100 -> Plus
chr2R 6306987..6307190 621..824 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:18 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
Prx2540-2-RA 1..663 87..749 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:22:07 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
Prx2540-2-RA 1..663 87..749 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:25:28 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
Prx2540-2-RA 1..663 87..749 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:00 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
Prx2540-2-RA 1..663 87..749 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:29:03 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
Prx2540-2-RA 1..663 87..749 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:49:06 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
Prx2540-2-RA 1..856 1..855 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:22:07 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
Prx2540-2-RA 1..854 2..855 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:25:28 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
Prx2540-2-RA 1..856 1..855 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:00 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
Prx2540-2-RA 1..856 1..855 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:29:03 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
Prx2540-2-RA 1..856 1..855 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:20:34 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10419527..10419761 621..855 100   Plus
2R 10418718..10418887 1..169 99 -> Plus
2R 10418950..10419324 170..544 100 -> Plus
2R 10419388..10419463 545..620 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:20:34 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10419527..10419761 621..855 100   Plus
2R 10418718..10418887 1..169 99 -> Plus
2R 10418950..10419324 170..544 100 -> Plus
2R 10419388..10419463 545..620 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:20:34 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10419527..10419761 621..855 100   Plus
2R 10418718..10418887 1..169 99 -> Plus
2R 10418950..10419324 170..544 100 -> Plus
2R 10419388..10419463 545..620 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:25:28 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6306223..6306392 1..169 99 -> Plus
arm_2R 6306455..6306829 170..544 100 -> Plus
arm_2R 6306893..6306968 545..620 100 -> Plus
arm_2R 6307032..6307266 621..855 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:31:41 Download gff for RH69586.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10420149..10420523 170..544 100 -> Plus
2R 10420587..10420662 545..620 100 -> Plus
2R 10420726..10420960 621..855 100   Plus
2R 10419917..10420086 1..169 99 -> Plus

RH69586.pep Sequence

Translation from 86 to 748

> RH69586.pep
MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRI
AVHQPEFAKRNTKCLAHSVDALNSHVDWVNDIKSYCLDIPGDFPYPIIAD
PTRDLAVSLGMLDEEQKKDPEVGKTIRALFIISPDHKVRLSMFYPMSTGR
NVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTVTDEEAHKLFPK
GFDKVSMPSGVNYVRTTDNY*

RH69586.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12122-PA 220 GF12122-PA 1..220 1..220 1145 96.4 Plus
Dana\GF12795-PA 220 GF12795-PA 1..220 1..220 1144 96.4 Plus
Dana\GF12124-PA 220 GF12124-PA 1..220 1..220 1143 95.9 Plus
Dana\GF14910-PA 222 GF14910-PA 6..219 1..217 583 52.5 Plus
Dana\GF19402-PA 194 GF19402-PA 24..188 19..192 238 34.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25209-PA 220 GG25209-PA 1..220 1..220 1175 99.1 Plus
Dere\GG24165-PA 220 GG24165-PA 1..220 1..220 1171 98.6 Plus
Dere\GG24478-PA 222 GG24478-PA 6..219 1..217 578 51.6 Plus
Dere\GG15885-PA 196 GG15885-PA 4..193 1..196 248 34 Plus
Dere\GG17772-PA 194 GG17772-PA 24..188 19..192 242 34.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20103-PA 220 GH20103-PA 1..220 1..220 1103 91.8 Plus
Dgri\GH20104-PA 220 GH20104-PA 1..220 1..220 1103 91.8 Plus
Dgri\GH21252-PA 220 GH21252-PA 1..220 1..220 1096 91.8 Plus
Dgri\GH22477-PA 184 GH22477-PA 1..184 1..220 861 75.9 Plus
Dgri\GH11051-PA 225 GH11051-PA 6..219 1..217 572 51.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Prx2540-2-PA 220 CG11765-PA 1..220 1..220 1177 100 Plus
Prx2540-1-PA 220 CG12405-PA 1..220 1..220 1170 99.1 Plus
CG12896-PA 220 CG12896-PA 1..220 1..220 1163 98.2 Plus
Prx6005-PA 222 CG3083-PA 6..219 1..217 571 51.2 Plus
Jafrac1-PE 194 CG1633-PE 24..188 19..192 231 34.9 Plus
Jafrac1-PD 194 CG1633-PD 24..188 19..192 231 34.9 Plus
Jafrac1-PC 194 CG1633-PC 24..188 19..192 231 34.9 Plus
Jafrac1-PA 194 CG1633-PA 24..188 19..192 231 34.9 Plus
Jafrac1-PB 194 CG1633-PB 24..188 19..192 231 34.9 Plus
Prx3-PA 234 CG5826-PA 40..232 1..200 230 33 Plus
CG6888-PA 196 CG6888-PA 4..193 1..196 229 32 Plus
Jafrac2-PC 242 CG1274-PC 81..240 29..200 191 32 Plus
Jafrac2-PB 242 CG1274-PB 81..240 29..200 191 32 Plus
Jafrac2-PA 242 CG1274-PA 81..240 29..200 191 32 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20198-PA 220 GI20198-PA 1..220 1..220 1126 93.6 Plus
Dmoj\GI17568-PA 224 GI17568-PA 6..219 1..217 581 52.1 Plus
Dmoj\GI16105-PA 194 GI16105-PA 24..188 19..192 242 34.3 Plus
Dmoj\GI22813-PA 233 GI22813-PA 39..231 1..200 237 33 Plus
Dmoj\GI16636-PA 243 GI16636-PA 53..241 3..200 217 32.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11593-PA 220 GL11593-PA 1..220 1..220 1149 96.8 Plus
Dper\GL26709-PA 168 GL26709-PA 6..165 1..217 327 37.8 Plus
Dper\GL26916-PA 194 GL26916-PA 24..188 19..192 246 34.9 Plus
Dper\GL13701-PA 233 GL13701-PA 39..228 1..195 235 32.3 Plus
Dper\GL20930-PA 194 GL20930-PA 33..179 29..184 208 34 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11614-PA 220 GA11614-PA 1..220 1..220 1149 96.8 Plus
Dpse\GA15914-PA 222 GA15914-PA 6..219 1..217 576 53 Plus
Dpse\GA14060-PA 200 GA14060-PA 30..194 19..192 246 34.9 Plus
Dpse\GA19159-PA 233 GA19159-PA 39..228 1..195 235 32.3 Plus
Dpse\GA28632-PA 194 GA28632-PA 4..179 3..184 209 32.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21216-PA 220 GM21216-PA 1..220 1..220 1171 99.1 Plus
Dsec\GM20524-PA 220 GM20524-PA 1..220 1..220 1165 98.6 Plus
Dsec\GM21213-PA 220 GM21213-PA 1..220 1..220 1164 98.6 Plus
Dsec\GM18185-PA 222 GM18185-PA 6..219 1..217 563 50.2 Plus
Dsec\GM25516-PA 196 GM25516-PA 4..193 1..196 245 33.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25985-PA 220 GD25985-PA 1..220 1..220 1165 98.6 Plus
Dsim\GD25983-PA 220 GD25983-PA 1..220 1..220 1164 98.6 Plus
Dsim\GD22792-PA 222 GD22792-PA 6..219 1..217 572 50.7 Plus
Dsim\GD10738-PA 75 GD10738-PA 1..75 146..220 387 98.7 Plus
Dsim\GD14531-PA 196 GD14531-PA 4..193 1..196 245 33.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20147-PA 220 GJ20147-PA 1..220 1..220 1147 95.9 Plus
Dvir\GJ17911-PA 224 GJ17911-PA 6..219 1..217 572 51.6 Plus
Dvir\GJ15754-PA 194 GJ15754-PA 3..188 2..192 251 32.7 Plus
Dvir\GJ22817-PA 233 GJ22817-PA 39..231 1..200 244 34.5 Plus
Dvir\GJ11904-PA 195 GJ11904-PA 24..190 18..195 201 29.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18009-PA 220 GK18009-PA 1..220 1..220 1140 95.9 Plus
Dwil\GK17795-PA 220 GK17795-PA 1..220 1..220 1117 94.5 Plus
Dwil\GK24747-PA 222 GK24747-PA 5..219 1..217 562 51.8 Plus
Dwil\GK25196-PA 213 GK25196-PA 22..207 2..192 244 32.7 Plus
Dwil\GK19651-PA 196 GK19651-PA 4..193 1..196 229 33.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19359-PA 220 GE19359-PA 1..220 1..220 1169 98.6 Plus
Dyak\GE14982-PA 222 GE14982-PA 6..219 1..217 577 51.6 Plus
Dyak\GE21518-PA 94 GE21518-PA 1..94 1..153 305 49.7 Plus
Dyak\GE22230-PA 196 GE22230-PA 4..181 1..184 242 34 Plus
Dyak\Jafrac1-PA 194 GE17062-PA 24..188 19..192 242 34.9 Plus

RH69586.hyp Sequence

Translation from 86 to 748

> RH69586.hyp
MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRI
AVHQPEFAKRNTKCLAHSVDALNSHVDWVNDIKSYCLDIPGDFPYPIIAD
PTRDLAVSLGMLDEEQKKDPEVGKTIRALFIISPDHKVRLSMFYPMSTGR
NVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTVTDEEAHKLFPK
GFDKVSMPSGVNYVRTTDNY*

RH69586.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
Prx2540-2-PA 220 CG11765-PA 1..220 1..220 1177 100 Plus
Prx2540-1-PA 220 CG12405-PA 1..220 1..220 1170 99.1 Plus
CG12896-PA 220 CG12896-PA 1..220 1..220 1163 98.2 Plus
Prx6005-PA 222 CG3083-PA 6..219 1..217 571 51.2 Plus
Jafrac1-PE 194 CG1633-PE 24..188 19..192 231 34.9 Plus