Clone RH69723 Report

Search the DGRC for RH69723

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:697
Well:23
Vector:pFlc-1
Associated Gene/TranscriptCG7646-RB
Protein status:RH69723.pep: gold
Preliminary Size:702
Sequenced Size:614

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7641 2002-01-01 Sim4 clustering to Release 2
CG7646 2002-04-21 Blastp of sequenced clone
CG7646 2008-04-29 Release 5.5 accounting
CG7646 2008-08-15 Release 5.9 accounting
Nca 2008-08-15 Release 5.9 accounting
CG7646 2008-12-18 5.12 accounting
Nca 2008-12-18 5.12 accounting

Clone Sequence Records

RH69723.complete Sequence

614 bp (614 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113623

> RH69723.complete
GACCCCTAAATTTGTTGTATTGATTGTGTTTTGGTCGAATAAGTTTATTG
CATTTGCGAAAAGTGATTTTGTTTAGCCTAGCGGGTAGCAGAAATGTGCC
TAAAATCAATGTGTCATTTTCGTTCAGCATATTAGCCTCAGTAGGTAAAT
AATGCTTTGACTTGGTCGACGGAAATCAAACTGATGAATTTTTACTCGCA
ATAGATGTAACTTCAAGCGGAACACCGGAGGAAAAGCTAAAGTGGGCCTT
TCGAATGTACGATGTCGATGGCAATGGTGTTATAGACATACAAGAAATGA
CCAAAATTGTTCAGGCAATTTATGACATGCTAGGAGCGTGCTCATCTAAT
CGTCCAGCTGATTCAGCAGAAGAAAGAGCAAAAAATATTTTTGCAAAAAT
GGACGAAAATAACGATGGTCAATTAACCCAAGATGAGTTCTTGAAAGGAT
GCTTGCAAGATGAGGAGTTGTCAAAAATGTTGGCACCATAAACAATTATA
TCCTACAATATGTGTGTATTTGATGAAATCAGTAATGAAATGTATAAATA
CTTAATTTATATTTCTTATACTAAAATTAAACTACTATAAAACTATGCAA
AAAAAAAAAAAAAA

RH69723.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-RB 598 CG7646-RB 2..598 2..598 2985 100 Plus
CG7646-RA 1135 CG7646-RA 618..1032 186..600 2075 100 Plus
Nca-RA 863 Nca-RA 1..178 8..185 890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19984940..19985227 311..598 1440 100 Plus
chr3L 24539361 chr3L 19984689..19984818 186..315 650 100 Plus
chr3L 24539361 chr3L 19981235..19981360 2..127 630 100 Plus
chr3L 24539361 chr3L 19982575..19982638 123..186 320 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19995625..19995914 311..600 1450 100 Plus
3L 28110227 3L 19995374..19995503 186..315 650 100 Plus
3L 28110227 3L 19991917..19992042 2..127 630 100 Plus
3L 28110227 3L 19993260..19993323 123..186 320 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19988725..19989014 311..600 1450 100 Plus
3L 28103327 3L 19988474..19988603 186..315 650 100 Plus
3L 28103327 3L 19985017..19985142 2..127 630 100 Plus
3L 28103327 3L 19986360..19986423 123..186 320 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:50:00 has no hits.

RH69723.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:50:44 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19981234..19981360 1..127 99 -> Plus
chr3L 19982580..19982637 128..185 100 -> Plus
chr3L 19984689..19984817 186..314 100 -> Plus
chr3L 19984944..19985227 315..598 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:21 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 256..561 186..491 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:45:58 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 256..561 186..491 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:19:51 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 256..561 186..491 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:26 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 256..561 186..491 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:49:14 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 256..561 186..491 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:57:14 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RB 2..598 2..598 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:45:58 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RB 2..598 2..598 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:19:51 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RB 30..627 1..598 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:26 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RB 2..598 2..598 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:49:14 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RB 30..627 1..598 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:50:44 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19991916..19992042 1..127 99 -> Plus
3L 19993265..19993322 128..185 100 -> Plus
3L 19995374..19995502 186..314 100 -> Plus
3L 19995629..19995912 315..598 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:50:44 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19991916..19992042 1..127 99 -> Plus
3L 19993265..19993322 128..185 100 -> Plus
3L 19995374..19995502 186..314 100 -> Plus
3L 19995629..19995912 315..598 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:50:44 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19991916..19992042 1..127 99 -> Plus
3L 19993265..19993322 128..185 100 -> Plus
3L 19995374..19995502 186..314 100 -> Plus
3L 19995629..19995912 315..598 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:19:51 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19988474..19988602 186..314 100 -> Plus
arm_3L 19985016..19985142 1..127 99 -> Plus
arm_3L 19986365..19986422 128..185 100 -> Plus
arm_3L 19988729..19989012 315..598 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:31 Download gff for RH69723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19988729..19989012 315..598 100   Plus
3L 19985016..19985142 1..127 99 -> Plus
3L 19986365..19986422 128..185 100 -> Plus
3L 19988474..19988602 186..314 100 -> Plus

RH69723.pep Sequence

Translation from 254 to 490

> RH69723.pep
MYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMD
ENNDGQLTQDEFLKGCLQDEELSKMLAP*

RH69723.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:50:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23610-PA 186 GF23610-PA 109..186 1..78 409 100 Plus
Dana\GF23611-PA 233 GF23611-PA 107..173 1..66 157 48.5 Plus
Dana\GF22357-PA 458 GF22357-PA 54..131 1..77 153 38.5 Plus
Dana\GF22427-PA 187 GF22427-PA 107..183 1..77 148 39 Plus
Dana\GF22428-PA 187 GF22428-PA 107..183 1..77 140 37.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:50:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16075-PA 186 GG16075-PA 109..186 1..78 409 100 Plus
Dere\GG16076-PA 190 GG16076-PA 107..183 1..76 165 44.9 Plus
Dere\GG18869-PA 195 GG18869-PA 112..189 1..77 154 38.5 Plus
Dere\GG19152-PA 220 GG19152-PA 140..216 1..77 148 39 Plus
Dere\GG19154-PA 187 GG19154-PA 107..183 1..77 140 37.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14389-PA 186 GH14389-PA 109..186 1..78 409 100 Plus
Dgri\GH14390-PA 190 GH14390-PA 107..183 1..76 169 46.2 Plus
Dgri\GH12227-PA 494 GH12227-PA 32..109 1..77 154 38.5 Plus
Dgri\GH17717-PA 187 GH17717-PA 107..183 1..77 148 39 Plus
Dgri\GH17718-PA 187 GH17718-PA 107..183 1..77 140 37.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-PB 78 CG7646-PB 1..78 1..78 402 100 Plus
CG7646-PC 186 CG7646-PC 109..186 1..78 402 100 Plus
CG7646-PA 186 CG7646-PA 109..186 1..78 402 100 Plus
Nca-PA 190 CG7641-PA 107..183 1..76 163 44.9 Plus
CG44422-PE 363 CG44422-PE 280..357 1..77 158 38.5 Plus
CG44422-PB 436 CG44422-PB 353..430 1..77 158 38.5 Plus
CG44422-PD 439 CG44422-PD 356..433 1..77 158 38.5 Plus
CG44422-PC 450 CG44422-PC 367..444 1..77 158 38.5 Plus
CG44422-PF 673 CG44422-PF 280..357 1..77 158 38.5 Plus
CG44422-PA 746 CG44422-PA 353..430 1..77 158 38.5 Plus
Frq1-PE 187 CG5744-PE 107..183 1..77 150 39 Plus
Frq1-PD 187 CG5744-PD 107..183 1..77 150 39 Plus
Frq1-PC 187 CG5744-PC 107..183 1..77 150 39 Plus
Frq1-PB 187 CG5744-PB 107..183 1..77 150 39 Plus
Frq2-PD 187 CG5907-PD 107..183 1..77 142 37.7 Plus
Frq2-PC 187 CG5907-PC 107..183 1..77 142 37.7 Plus
Frq2-PB 187 CG5907-PB 107..183 1..77 142 37.7 Plus
Frq2-PA 187 CG5907-PA 107..183 1..77 142 37.7 Plus
CG5890-PD 206 CG5890-PD 123..199 1..76 135 34.6 Plus
CG5890-PC 206 CG5890-PC 123..199 1..76 135 34.6 Plus
CG5890-PA 206 CG5890-PA 123..199 1..76 135 34.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11333-PA 186 GI11333-PA 109..186 1..78 409 100 Plus
Dmoj\GI11334-PA 190 GI11334-PA 107..183 1..76 169 46.2 Plus
Dmoj\GI15760-PA 532 GI15760-PA 112..189 1..77 156 38.5 Plus
Dmoj\GI15464-PA 188 GI15464-PA 108..184 1..77 148 39 Plus
Dmoj\GI15466-PA 187 GI15466-PA 107..183 1..77 140 37.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:50:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11893-PA 186 GL11893-PA 109..186 1..78 409 100 Plus
Dper\GL11894-PA 190 GL11894-PA 107..183 1..76 165 44.9 Plus
Dper\GL20299-PA 195 GL20299-PA 112..189 1..77 155 38.5 Plus
Dper\GL26964-PA 187 GL26964-PA 107..183 1..77 148 39 Plus
Dper\GL26965-PA 187 GL26965-PA 107..183 1..77 140 37.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:50:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10762-PA 195 GA10762-PA 112..189 1..77 155 38.5 Plus
Dpse\GA19219-PA 187 GA19219-PA 107..183 1..77 140 37.7 Plus
Dpse\GA19207-PA 206 GA19207-PA 123..199 1..76 135 34.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19731-PA 186 GM19731-PA 109..186 1..78 409 100 Plus
Dsec\GM19732-PA 190 GM19732-PA 107..183 1..76 165 44.9 Plus
Dsec\GM11254-PA 421 GM11254-PA 31..108 1..77 160 38.5 Plus
Dsec\GM22884-PA 106 GM22884-PA 26..102 1..77 148 39 Plus
Dsec\GM22886-PA 187 GM22886-PA 107..183 1..77 140 37.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14846-PA 186 GD14846-PA 109..186 1..78 409 100 Plus
Dsim\GD14847-PA 190 GD14847-PA 107..183 1..76 165 44.9 Plus
Dsim\GD15997-PA 427 GD15997-PA 31..108 1..77 159 38.5 Plus
Dsim\GD24850-PA 187 GD24850-PA 107..183 1..77 148 39 Plus
Dsim\GD24687-PA 197 GD24687-PA 107..183 1..77 139 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11589-PA 186 GJ11589-PA 109..186 1..78 409 100 Plus
Dvir\GJ11590-PA 190 GJ11590-PA 107..183 1..76 169 46.2 Plus
Dvir\GJ19176-PA 187 GJ19176-PA 107..183 1..77 140 37.7 Plus
Dvir\GJ22734-PA 206 GJ22734-PA 123..199 1..76 136 35.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20281-PA 186 GK20281-PA 109..186 1..78 409 100 Plus
Dwil\GK20284-PA 190 GK20284-PA 107..183 1..76 165 44.9 Plus
Dwil\GK16520-PA 175 GK16520-PA 92..169 1..77 157 39.7 Plus
Dwil\GK19999-PA 187 GK19999-PA 107..183 1..77 148 39 Plus
Dwil\GK12862-PA 206 GK12862-PA 123..199 1..76 137 35.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19641-PA 186 GE19641-PA 109..186 1..78 409 100 Plus
Dyak\GE23223-PA 78 GE23223-PA 1..78 1..78 408 100 Plus
Dyak\GE19642-PA 190 GE19642-PA 107..183 1..76 165 44.9 Plus
Dyak\GE23224-PA 190 GE23224-PA 107..183 1..76 165 44.9 Plus
Dyak\GE17310-PA 508 GE17310-PA 103..180 1..77 158 38.5 Plus

RH69723.hyp Sequence

Translation from 254 to 490

> RH69723.hyp
MYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMD
ENNDGQLTQDEFLKGCLQDEELSKMLAP*

RH69723.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-PB 78 CG7646-PB 1..78 1..78 402 100 Plus
CG7646-PC 186 CG7646-PC 109..186 1..78 402 100 Plus
CG7646-PA 186 CG7646-PA 109..186 1..78 402 100 Plus
Nca-PA 190 CG7641-PA 107..183 1..76 163 44.9 Plus
CG44422-PE 363 CG44422-PE 280..357 1..77 158 38.5 Plus