Clone RH70420 Report

Search the DGRC for RH70420

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:704
Well:20
Vector:pFlc-1
Associated Gene/TranscriptCG7203-RB
Protein status:RH70420.pep: gold
Preliminary Size:694
Sequenced Size:723

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7203 2002-01-01 Sim4 clustering to Release 2
CG7203 2002-04-26 Blastp of sequenced clone
CG7203 2003-01-01 Sim4 clustering to Release 3
CG7203 2008-04-29 Release 5.5 accounting
CG7203 2008-08-15 Release 5.9 accounting
CG7203 2008-12-18 5.12 accounting

Clone Sequence Records

RH70420.complete Sequence

723 bp (723 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113624

> RH70420.complete
AAGTGTGGATGCGAGTTAGTTTCGTTTCAAGCGTCACTGAGATCACAAAA
GCCAACATGAAGTTCGCCGTTGTCGTAGTCCTGTTCGCTTTGGCCTGGGG
TGTCAACAGCTCGGTGGTGCCTCTCCTGACCTCCGCCCATGGTCTGGTGG
TCGGTTCTCCCGCCGTCGCCGGTTCGGTGGCCATCCAGGCATCTGCGGTT
CCCGCTGCCGTTCCCCTGTCCCTGTCCCCAGCCGGACCCGTGCTCATCCA
GTCTGGACCAGCGGTGGTTGCCGCTCCCGTTCCCGCCGCTGTGGTTGCTG
CCCACGCCCCCGCCGTGGTGGCCGTCGCCGCTCCGGAGGCCAGCTATGTG
GCCAAGACCCGTGGAGCTGTCCATGTGGCTCCTCTGCCAGGACATGTGCA
GTCCGCTGCTTCCGTGAACTTGGAACCCGCACCAGGCACCTGGTAATCAC
CTGAAATGACTTCTGGATTACCCCTACATTGATCCTGACCGCCACTTGCT
CGCATCTTTACCACATTTTTTGGTTTTTTAAGTTACCGAAAGGTCTGTCC
TCTGCTGAGATCCCGTTGGGTTCTCATTTCTTCAGCAATCTAAGTCAATC
CTATCCAGTCTATCGCTTTCCGCTTTACTCTCTGGTCTATATTTATCCAC
CCCGCTGTTGTCACATGGAAATTTGTTTCTTTTTGAATAAAAAAATGTTA
TTAAAACAAAAAAAAAAAAAAAA

RH70420.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7203.e 1192 CG7203.e 442..1136 14..708 3475 100 Plus
CG7203.d 1192 CG7203.d 442..1136 14..708 3475 100 Plus
CG7203.c 1433 CG7203.c 683..1377 14..708 3475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7751262..7751909 707..61 3190 99.8 Minus
chr2L 23010047 chr2L 7752195..7752243 62..14 245 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7752169..7752816 708..61 3240 100 Minus
2L 23513712 2L 7753102..7753150 62..14 245 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7752169..7752816 708..61 3240 100 Minus
2L 23513712 2L 7753102..7753150 62..14 245 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:46:26 has no hits.

RH70420.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:47:18 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7751262..7751638 332..707 99 == Minus
chr2L 7751701..7751907 63..269 100 <- Minus
chr2L 7752195..7752241 16..62 100 -- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:34:31 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
CG7203-RB 1..390 57..446 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:02:12 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
CG7203-RB 1..390 57..446 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:52:48 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
CG7203-RB 1..390 57..446 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:52:35 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
CG7203-RB 1..390 57..446 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:32:18 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
CG7203-RB 1..390 57..446 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:34:31 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
CG7203-RB 1..700 8..707 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:02:11 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
CG7203-RB 1..700 8..707 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:52:48 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
CG7203-RB 1..697 13..707 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:52:35 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
CG7203-RB 1..700 8..707 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:18 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
CG7203-RB 1..697 13..707 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:18 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7752170..7752814 63..707 100 <- Minus
2L 7753102..7753148 16..62 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:18 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7752170..7752814 63..707 100 <- Minus
2L 7753102..7753148 16..62 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:18 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7752170..7752814 63..707 100 <- Minus
2L 7753102..7753148 16..62 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:52:48 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7752170..7752814 63..707 100 <- Minus
arm_2L 7753102..7753148 16..62 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:24:36 Download gff for RH70420.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7752170..7752814 63..707 100 <- Minus
2L 7753102..7753148 16..62 100 <- Minus

RH70420.hyp Sequence

Translation from 2 to 445

> RH70420.hyp
VWMRVSFVSSVTEITKANMKFAVVVVLFALAWGVNSSVVPLLTSAHGLVV
GSPAVAGSVAIQASAVPAAVPLSLSPAGPVLIQSGPAVVAAPVPAAVVAA
HAPAVVAVAAPEASYVAKTRGAVHVAPLPGHVQSAASVNLEPAPGTW*

RH70420.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7203-PC 129 CG7203-PC 1..129 19..147 632 100 Plus
CG7203-PB 129 CG7203-PB 1..129 19..147 632 100 Plus
Acp1-PA 135 CG7216-PA 1..134 19..146 276 52.9 Plus
CG31904-PB 403 CG31904-PB 221..341 18..132 214 48.8 Plus
CG31904-PD 403 CG31904-PD 221..341 18..132 214 48.8 Plus

RH70420.pep Sequence

Translation from 8 to 445

> RH70420.pep
MRVSFVSSVTEITKANMKFAVVVVLFALAWGVNSSVVPLLTSAHGLVVGS
PAVAGSVAIQASAVPAAVPLSLSPAGPVLIQSGPAVVAAPVPAAVVAAHA
PAVVAVAAPEASYVAKTRGAVHVAPLPGHVQSAASVNLEPAPGTW*

RH70420.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14584-PA 138 GF14584-PA 1..137 17..144 408 78.8 Plus
Dana\GF14586-PA 134 GF14586-PA 1..134 17..145 142 43.3 Plus
Dana\GF14585-PA 145 GF14585-PA 89..144 78..144 135 44.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23510-PA 150 GG23510-PA 1..150 1..145 558 90.7 Plus
Dere\GG23512-PA 133 GG23512-PA 1..132 17..144 149 36.4 Plus
Dere\GG23511-PA 142 GG23511-PA 95..141 98..144 139 59.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13216-PA 129 GH13216-PA 1..128 17..144 375 76 Plus
Dgri\GH10483-PA 136 GH10483-PA 1..135 17..144 183 45.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG7203-PC 129 CG7203-PC 1..129 17..145 632 100 Plus
CG7203-PB 129 CG7203-PB 1..129 17..145 632 100 Plus
Acp1-PA 135 CG7216-PA 1..134 17..144 276 52.9 Plus
CG31904-PB 403 CG31904-PB 221..341 16..130 214 48.8 Plus
CG31904-PD 403 CG31904-PD 221..341 16..130 214 48.8 Plus
CG7214-PA 142 CG7214-PA 1..141 17..144 164 36.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14512-PA 125 GI14512-PA 1..124 17..144 308 71.5 Plus
Dmoj\GI18000-PA 144 GI18000-PA 1..143 17..144 208 48.6 Plus
Dmoj\GI17999-PA 142 GI17999-PA 1..141 17..144 161 37.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18852-PA 399 GL18852-PA 282..399 25..145 360 82.3 Plus
Dper\GL18854-PA 129 GL18854-PA 1..128 17..144 164 48.5 Plus
Dper\GL18853-PA 148 GL18853-PA 86..147 82..144 144 52.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20178-PA 126 GA20178-PA 1..126 17..145 396 83.3 Plus
Dpse\GA25829-PA 136 GA25829-PA 1..135 17..144 156 41.1 Plus
Dpse\GA20185-PA 148 GA20185-PA 86..147 82..144 144 52.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13361-PA 129 GM13361-PA 1..129 17..145 579 98.4 Plus
Dsec\GM13384-PA 135 GM13384-PA 1..134 17..144 155 50.4 Plus
Dsec\GM13372-PA 142 GM13372-PA 95..141 98..144 139 59.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22471-PA 145 GD22471-PA 1..145 1..145 653 97.2 Plus
Dsim\GD22473-PA 135 GD22473-PA 1..134 17..144 155 50.4 Plus
Dsim\GD22472-PA 142 GD22472-PA 95..141 98..144 139 59.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16283-PA 130 GJ16283-PA 1..130 17..145 369 76.3 Plus
Dvir\GJ19615-PA 131 GJ19615-PA 1..130 17..144 185 50.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24642-PA 146 GK24642-PA 1..146 17..145 407 71.4 Plus
Dwil\GK24644-PA 137 GK24644-PA 1..136 17..144 146 44.6 Plus
Dwil\GK24643-PA 138 GK24643-PA 100..137 107..144 133 68.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18337-PA 138 GE18337-PA 1..138 17..145 401 80.4 Plus
Dyak\GE18339-PA 135 GE18339-PA 1..134 17..144 155 50.4 Plus
Dyak\GE18338-PA 142 GE18338-PA 95..141 98..144 139 59.6 Plus