Clone RH70762 Report

Search the DGRC for RH70762

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:707
Well:62
Vector:pFlc-1
Associated Gene/TranscriptObp99a-RA
Protein status:RH70762.pep: gold
Preliminary Size:544
Sequenced Size:573

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18111 2002-01-01 Sim4 clustering to Release 2
CG18111 2002-04-26 Blastp of sequenced clone
CG18111 2003-01-01 Sim4 clustering to Release 3
Obp99a 2008-04-29 Release 5.5 accounting
Obp99a 2008-08-15 Release 5.9 accounting
Obp99a 2008-12-18 5.12 accounting

Clone Sequence Records

RH70762.complete Sequence

573 bp (573 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113625

> RH70762.complete
GACAGTCTTCGCTCGATCGCTGGAGGAATACATACATAGGTGGAAAGAAA
GTGAAAATGAAGGTTTTCGTTGCCATCTGCGTGCTGATTGGACTGGCCTC
CGCCGACTATGTGGTGAAGAACCGACACGACATGCTGGCCTACCGCGATG
AGTGCGTCAAGGAGCTGGCCGTGCCCGTGGATCTGGTGGAGAAGTACCAG
AAGTGGGAGTACCCCAACGACGCCAAGACCCAGTGCTACATCAAGTGCGT
CTTCACCAAGTGGGGCCTGTTCGACGTCCAGAGCGGTTTCAACGTGGAGA
ACATCCACCAACAGCTGGTGGGCAACCACGCTGACCACAACGAGGCCTTC
CACGCCTCCTTGGCCGCCTGCGTGGACAAGAACGAGCAGGGATCCAATGC
CTGCGAGTGGGCCTACCGCGGAGCCACCTGTCTGCTGAAGGAGAACCTGG
CCCAGATCCAGAAGAGCCTGGCCCCGAAGGCCTAGTGGCTTAGGTCCTAG
TTGGACGGATGTAACGATAAGCATTAGTTTAGTTAATAAAGTAATTGATT
TCCCATACAAAAAAAAAAAAAAA

RH70762.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99a-RA 922 Obp99a-RA 229..787 2..560 2795 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25494435..25494898 95..558 2320 100 Plus
chr3R 27901430 chr3R 25494274..25494368 2..96 445 97.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29671822..29672287 95..560 2330 100 Plus
3R 32079331 3R 29671661..29671755 2..96 475 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29412653..29413118 95..560 2330 100 Plus
3R 31820162 3R 29412492..29412586 2..96 475 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:14:13 has no hits.

RH70762.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:15:18 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25494273..25494367 1..95 96 -> Plus
chr3R 25494436..25494898 96..558 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:37 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 1..429 57..485 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:04:06 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 1..429 57..485 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:08:22 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 1..429 57..485 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:49:15 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 1..429 57..485 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:00:17 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 1..429 57..485 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:50:34 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 1..558 2..558 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:04:06 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 1..558 2..558 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:08:22 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 4..561 1..558 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:49:16 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 1..558 2..558 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:00:17 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 4..561 1..558 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:18 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29671660..29671754 1..95 98 -> Plus
3R 29671823..29672285 96..558 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:18 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29671660..29671754 1..95 98 -> Plus
3R 29671823..29672285 96..558 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:18 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29671660..29671754 1..95 98 -> Plus
3R 29671823..29672285 96..558 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:08:22 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25497382..25497476 1..95 98 -> Plus
arm_3R 25497545..25498007 96..558 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:23:52 Download gff for RH70762.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29412654..29413116 96..558 100   Plus
3R 29412491..29412585 1..95 98 -> Plus

RH70762.hyp Sequence

Translation from 2 to 484

> RH70762.hyp
QSSLDRWRNTYIGGKKVKMKVFVAICVLIGLASADYVVKNRHDMLAYRDE
CVKELAVPVDLVEKYQKWEYPNDAKTQCYIKCVFTKWGLFDVQSGFNVEN
IHQQLVGNHADHNEAFHASLAACVDKNEQGSNACEWAYRGATCLLKENLA
QIQKSLAPKA*

RH70762.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99a-PB 142 CG18111-PB 1..142 19..160 764 100 Plus
Obp99a-PA 142 CG18111-PA 1..142 19..160 764 100 Plus
Obp99b-PB 149 CG7592-PB 3..147 23..156 290 37.9 Plus
Obp99b-PA 149 CG7592-PA 3..147 23..156 290 37.9 Plus
Obp44a-PB 143 CG2297-PB 1..140 17..156 281 41.8 Plus

RH70762.pep Sequence

Translation from 56 to 484

> RH70762.pep
MKVFVAICVLIGLASADYVVKNRHDMLAYRDECVKELAVPVDLVEKYQKW
EYPNDAKTQCYIKCVFTKWGLFDVQSGFNVENIHQQLVGNHADHNEAFHA
SLAACVDKNEQGSNACEWAYRGATCLLKENLAQIQKSLAPKA*

RH70762.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23357-PA 142 GF23357-PA 1..142 1..142 649 81.7 Plus
Dana\GF11209-PA 144 GF11209-PA 5..140 3..138 280 41.6 Plus
Dana\GF22870-PA 151 GF22870-PA 1..149 1..138 272 34 Plus
Dana\GF18627-PA 145 GF18627-PA 8..145 3..139 201 31.9 Plus
Dana\GF22872-PA 164 GF22872-PA 1..145 1..137 196 30.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11676-PA 144 GG11676-PA 1..144 1..142 683 90.3 Plus
Dere\GG10672-PA 143 GG10672-PA 5..140 3..138 274 40.9 Plus
Dere\GG10577-PA 145 GG10577-PA 15..145 9..139 214 32.8 Plus
Dere\GG12008-PA 151 GG12008-PA 2..132 1..132 136 25.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18907-PA 149 GH18907-PA 1..142 1..142 577 73.2 Plus
Dgri\GH13991-PA 157 GH13991-PA 32..155 16..138 331 45.2 Plus
Dgri\GH19983-PA 144 GH19983-PA 5..143 3..141 283 42.1 Plus
Dgri\GH14285-PA 149 GH14285-PA 8..143 1..136 213 33.1 Plus
Dgri\GH23278-PA 242 GH23278-PA 1..49 1..49 186 69.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99a-PB 142 CG18111-PB 1..142 1..142 764 100 Plus
Obp99a-PA 142 CG18111-PA 1..142 1..142 764 100 Plus
Obp99b-PB 149 CG7592-PB 3..147 5..138 290 37.9 Plus
Obp99b-PA 149 CG7592-PA 3..147 5..138 290 37.9 Plus
Obp44a-PB 143 CG2297-PB 5..140 3..138 278 42.3 Plus
Obp44a-PA 143 CG2297-PA 5..140 3..138 278 42.3 Plus
Obp83g-PA 146 CG31558-PA 17..146 10..139 189 30 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23406-PA 142 GI23406-PA 1..142 1..142 552 67.6 Plus
Dmoj\GI22335-PA 154 GI22335-PA 31..152 18..138 318 43.4 Plus
Dmoj\GI20270-PA 144 GI20270-PA 1..143 1..141 273 43.1 Plus
Dmoj\GI23179-PA 147 GI23179-PA 13..144 5..136 216 33.3 Plus
Dmoj\GI24193-PA 151 GI24193-PA 7..134 3..133 165 27.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13898-PA 142 GL13898-PA 1..142 1..142 654 84.5 Plus
Dper\GL13580-PA 156 GL13580-PA 28..154 14..138 290 39.4 Plus
Dper\GL17379-PA 144 GL17379-PA 5..141 3..138 270 40.6 Plus
Dper\GL23482-PA 145 GL23482-PA 20..145 14..139 168 28.6 Plus
Dper\GL13581-PA 151 GL13581-PA 2..133 1..132 139 26.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp99a-PA 142 GA14801-PA 1..142 1..142 654 84.5 Plus
Dpse\Obp99b-PA 156 GA20463-PA 28..154 14..138 290 39.4 Plus
Dpse\Obp44a-PA 144 GA15343-PA 5..141 3..138 270 40.6 Plus
Dpse\Obp83g-PA 145 GA16322-PA 20..145 14..139 171 29.4 Plus
Dpse\Obp99c-PA 135 GA26831-PA 17..117 30..132 141 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12800-PA 142 GM12800-PA 1..142 1..142 739 96.5 Plus
Dsec\GM12228-PA 149 GM12228-PA 3..147 5..138 288 37.9 Plus
Dsec\GM20719-PA 143 GM20719-PA 7..140 5..138 282 42.2 Plus
Dsec\GM10567-PA 145 GM10567-PA 15..145 9..139 197 30.5 Plus
Dsec\GM12230-PA 151 GM12230-PA 2..132 1..132 145 27.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp99a-PA 142 GD21447-PA 1..142 1..142 750 98.6 Plus
Dsim\Obp99b-PA 149 GD17685-PA 3..147 5..138 288 37.9 Plus
Dsim\Obp44a-PA 143 GD10185-PA 5..140 3..138 284 42.3 Plus
Dsim\Obp83g-PA 145 GD19559-PA 15..145 9..139 198 30.5 Plus
Dsim\Obp99c-PA 151 GD17690-PA 2..132 1..132 146 27.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp99a-PA 142 GJ10612-PA 1..142 1..142 562 70.4 Plus
Dvir\Obp99b-PA 162 GJ10523-PA 39..160 18..138 310 43.4 Plus
Dvir\Obp44a-PA 144 GJ20223-PA 5..143 3..141 278 42.1 Plus
Dvir\Obp83g-PA 148 GJ14492-PA 8..146 1..139 222 32.4 Plus
Dvir\Obp99c-PA 155 GJ10540-PA 7..139 3..138 155 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11908-PA 142 GK11908-PA 1..141 1..141 599 75.9 Plus
Dwil\GK11170-PA 158 GK11170-PA 30..156 15..138 308 42.5 Plus
Dwil\GK23043-PA 144 GK23043-PA 5..143 3..141 268 42.1 Plus
Dwil\GK14209-PA 144 GK14209-PA 7..144 3..139 218 34.1 Plus
Dwil\GK11172-PA 151 GK11172-PA 7..133 3..132 148 26.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Obp99a-PA 144 GE23865-PA 1..144 1..142 706 93.8 Plus
Dyak\GE10437-PA 149 GE10437-PA 3..147 5..138 302 40 Plus
Dyak\GE23275-PA 143 GE23275-PA 5..140 3..138 278 42.3 Plus
Dyak\GE24115-PA 145 GE24115-PA 15..145 9..139 194 31.3 Plus
Dyak\Obp99c-PA 151 GE10439-PA 7..132 3..132 149 26.9 Plus