Clone RH70879 Report

Search the DGRC for RH70879

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:708
Well:79
Vector:pFlc-1
Associated Gene/TranscriptCG30172-RA
Protein status:RH70879.pep: gold
Sequenced Size:446

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30172 2002-08-25 Blastp of sequenced clone
CG30172 2003-01-01 Sim4 clustering to Release 3
CG30172 2008-04-29 Release 5.5 accounting
CG30172 2008-08-15 Release 5.9 accounting
CG30172 2008-12-18 5.12 accounting

Clone Sequence Records

RH70879.complete Sequence

446 bp (446 high quality bases) assembled on 2002-08-25

GenBank Submission: BT001865

> RH70879.complete
ATTCAGTTATACTATACCGTCTCGCGTTCAGAAAGGATGCTACTTTTAAA
TAAAAACCGAGTGATTTCTTTGGTCGTTAATTTTATTTTTCTTATCATTC
TCATTTCATCGAGTGTCCAAGCGGATGAGAGAAACATTAACAAGCTGCTG
AACAACCAGGTGGTGGTCAGCCGCCAGATTATGTGCATCCTGGGCAAGAG
CGAATGCGACCAACTGGGACTTCAACTCAAAGCTGCCCTGCCAGAAGTTA
TAACCAGGAAATGCAGGAACTGCTCCCCACAACAGGCTCAAAAAGCGCAA
AAGCTGACCACATTTCTGCAAACTAGATACCCGGACGTATGGGCCATGCT
TCTAAGGAAGTACGACAGTGCCTAAATGGCATTTAAATGTTATTCTCATG
CATCGAATATAATAAACTAGTCTCGACACCAAAAAAAAAAAAAAAA

RH70879.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG30172-RA 789 CG30172-RA 296..723 1..428 2140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19917036..19917267 232..1 1160 100 Minus
chr2R 21145070 chr2R 19916714..19916911 428..231 990 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24030970..24031201 232..1 1160 100 Minus
2R 25286936 2R 24030648..24030845 428..231 990 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24032169..24032400 232..1 1160 100 Minus
2R 25260384 2R 24031847..24032044 428..231 990 100 Minus
Blast to na_te.dros performed 2019-03-15 16:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 2017..2092 138..63 109 63.6 Minus

RH70879.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:48:34 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19916712..19916909 233..430 99 <- Minus
chr2R 19917036..19917267 1..232 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:39 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 1..339 37..375 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:15:31 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 1..339 37..375 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:10:27 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 1..339 37..375 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:06:26 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 1..339 37..375 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:56 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 1..339 37..375 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:39:10 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 1..430 1..430 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:15:31 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 1..430 1..430 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:27 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 2..431 1..430 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:06:27 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 1..430 1..430 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:56 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 2..431 1..430 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:34 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24030646..24030843 233..430 99 <- Minus
2R 24030970..24031201 1..232 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:34 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24030646..24030843 233..430 99 <- Minus
2R 24030970..24031201 1..232 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:34 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24030646..24030843 233..430 99 <- Minus
2R 24030970..24031201 1..232 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:27 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19918169..19918366 233..430 99 <- Minus
arm_2R 19918493..19918724 1..232 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:38:25 Download gff for RH70879.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24032187..24032418 1..232 100   Minus
2R 24031863..24032060 233..430 99 <- Minus

RH70879.hyp Sequence

Translation from 0 to 374

> RH70879.hyp
IQLYYTVSRSERMLLLNKNRVISLVVNFIFLIILISSSVQADERNINKLL
NNQVVVSRQIMCILGKSECDQLGLQLKAALPEVITRKCRNCSPQQAQKAQ
KLTTFLQTRYPDVWAMLLRKYDSA*

RH70879.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG30172-PB 112 CG30172-PB 1..112 13..124 559 100 Plus
CG30172-PA 112 CG30172-PA 1..112 13..124 559 100 Plus
Phk-3-PC 121 CG9358-PC 29..109 42..122 142 30.9 Plus
Phk-3-PB 121 CG9358-PB 29..109 42..122 142 30.9 Plus
Phk-3-PA 121 CG9358-PA 29..109 42..122 142 30.9 Plus

RH70879.pep Sequence

Translation from 36 to 374

> RH70879.pep
MLLLNKNRVISLVVNFIFLIILISSSVQADERNINKLLNNQVVVSRQIMC
ILGKSECDQLGLQLKAALPEVITRKCRNCSPQQAQKAQKLTTFLQTRYPD
VWAMLLRKYDSA*

RH70879.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12039-PA 112 GF12039-PA 1..112 1..112 553 94.6 Plus
Dana\GF11516-PA 127 GF11516-PA 30..111 30..111 140 31.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19963-PA 112 GG19963-PA 1..112 1..112 566 97.3 Plus
Dere\GG19868-PA 121 GG19868-PA 4..109 11..110 147 30.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20166-PA 111 GH20166-PA 24..110 25..111 387 83.9 Plus
Dgri\GH22042-PA 122 GH22042-PA 29..110 30..111 147 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG30172-PB 112 CG30172-PB 1..112 1..112 559 100 Plus
CG30172-PA 112 CG30172-PA 1..112 1..112 559 100 Plus
Phk-3-PC 121 CG9358-PC 29..109 30..110 142 30.9 Plus
Phk-3-PB 121 CG9358-PB 29..109 30..110 142 30.9 Plus
Phk-3-PA 121 CG9358-PA 29..109 30..110 142 30.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20684-PA 111 GI20684-PA 12..111 12..112 410 77.2 Plus
Dmoj\GI19129-PA 126 GI19129-PA 30..111 30..111 147 32.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10431-PA 112 GL10431-PA 1..111 1..111 448 85.6 Plus
Dper\GL10889-PA 125 GL10889-PA 28..109 30..111 156 34.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15697-PA 112 GA15697-PA 1..111 1..111 448 85.6 Plus
Dpse\GA21727-PA 125 GA21727-PA 28..109 30..111 156 34.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18283-PA 112 GM18283-PA 1..112 1..112 572 99.1 Plus
Dsec\GM11771-PA 121 GM11771-PA 4..109 11..110 135 27.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24980-PA 112 GD24980-PA 1..112 1..112 572 99.1 Plus
Dsim\GD24902-PA 121 GD24902-PA 4..109 11..110 134 26.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20437-PA 111 GJ20437-PA 1..108 1..109 415 74.3 Plus
Dvir\GJ22262-PA 125 GJ22262-PA 30..111 30..111 149 32.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19383-PA 112 GK19383-PA 1..112 1..112 440 83 Plus
Dwil\GK19506-PA 127 GK19506-PA 30..111 30..111 143 31.7 Plus
Dwil\GK21931-PA 127 GK21931-PA 8..106 12..110 131 25.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11495-PA 112 GE11495-PA 1..112 1..112 569 98.2 Plus
Dyak\Phk-3-PA 121 GE11392-PA 4..109 11..110 143 29.2 Plus