Clone RH70969 Report

Search the DGRC for RH70969

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:709
Well:69
Vector:pFlc-1
Associated Gene/TranscriptVago-RC
Protein status:RH70969.pep: wuzgold
Preliminary Size:712
Sequenced Size:790

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2081 2002-01-01 Sim4 clustering to Release 2
CG2081 2002-04-26 Blastp of sequenced clone
CG2081 2003-01-01 Sim4 clustering to Release 3
Vago 2008-04-29 Release 5.5 accounting
Vago 2008-08-15 Release 5.9 accounting
Vago 2008-12-18 5.12 accounting

Clone Sequence Records

RH70969.complete Sequence

790 bp (790 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113627

> RH70969.complete
CAGAGTTGTGCGCTAAACTTTGCAAACGTCGGGCCAAATTCTGTCCGCCG
ATCTCAGTTCTTTCGAATAGCAAATTTTCACAAATGGAGTCAATTAGCAG
CATGATTTATTTAGTGGCCATGATGTCATTGATCATCGGTGGCAGCCAAG
CGATTCCTTATCGACCCTCGGCGTATCTGTACAATCAGCAGTACTGTATG
GATACATTGACGGGTCGGCAGCTTTATATCGGTGAAGTCTTCACGCGAGA
GGATCAGTGCGTCCGCATCCAATGCCTGGAAACGCTGCAACTCTGGGAGG
ATAGGTAAGCGTGCCGTACTAGTATGCCATAGCATCGGGTAACAGATCAT
CGTACTCATCCATGGTCCAGCTGCCAGGTGCCGAAACTGACGCAGGGCAA
TTGCACGCCAGTTCCATCGACGAACCCGCATGCCGAATATCCCCGATGCT
GCCCACTGTATGAGTGCAAGAGCTACGAGTCGAATTCGGGGGGAACTCTG
GAGCAGACCAACATATATGACCACTATGGTACTCTGCGATCATCCCATCT
CACTGAGATGATAGTGATCGACGGGCGGACACCCCCTCGTGGCGAGATTC
ACACGGCGTCGGCGAGGAAGTATCAGGTGTGAGAAGTGAACTGGTACTCT
GTTCCTAGGACTACTTAGTCTTTAGTGCAGATCTAATGTGTACAAATACA
AATGGAGTTTATTGCGGAATACTTGAATATGTTAAATAAATTTAAATTTC
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

RH70969.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-RC 748 Vago-RC 2..748 4..750 3735 100 Plus
Vago-RB 845 Vago-RB 385..767 369..751 1915 100 Plus
Vago-RB 845 Vago-RB 86..386 4..304 1505 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10980772..10981356 166..750 2895 99.7 Plus
chrX 22417052 chrX 10980542..10980703 4..165 795 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11089521..11090106 166..751 2930 100 Plus
X 23542271 X 11089291..11089452 4..165 810 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11097619..11098204 166..751 2930 100 Plus
X 23527363 X 11097389..11097550 4..165 810 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:58:52 has no hits.

RH70969.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:59:39 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10980541..10980703 1..165 98 -> Plus
chrX 10980772..10981356 166..750 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:41 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 1..219 84..302 100 == Plus
Vago-RB 220..483 369..632 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:22 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 1..219 84..302 100 == Plus
Vago-RB 220..483 369..632 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:52 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 1..219 84..302 100 == Plus
Vago-RB 220..483 369..632 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:49 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 1..219 84..302 100 == Plus
Vago-RB 220..483 369..632 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:16:23 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 1..219 84..302 100 == Plus
Vago-RB 220..483 369..632 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:33:05 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RC 2..748 4..750 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:22 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RC 2..748 4..750 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:52 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 2..300 4..302 100 == Plus
Vago-RB 301..682 369..750 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:49 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RC 2..748 4..750 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:16:23 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 2..300 4..302 100 == Plus
Vago-RB 301..682 369..750 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:39 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
X 11089290..11089452 1..165 98 -> Plus
X 11089521..11090105 166..750 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:39 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
X 11089290..11089452 1..165 98 -> Plus
X 11089521..11090105 166..750 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:39 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
X 11089290..11089452 1..165 98 -> Plus
X 11089521..11090105 166..750 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:52 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10983323..10983485 1..165 98 -> Plus
arm_X 10983554..10984138 166..750 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:27 Download gff for RH70969.complete
Subject Subject Range Query Range Percent Splice Strand
X 11097619..11098203 166..750 100   Plus
X 11097388..11097550 1..165 98 -> Plus

RH70969.hyp Sequence

Translation from 0 to 307

> RH70969.hyp
QLCAKLCKRRAKFCPPISVLSNSKFSQMESISSMIYLVAMMSLIIGGSQA
IPYRPSAYLYNQQYCMDTLTGRQLYIGEVFTREDQCVRIQCLETLQLWED
R*

RH70969.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-PD 160 CG2081-PD 1..73 28..100 381 100 Plus
Vago-PB 160 CG2081-PB 1..73 28..100 381 100 Plus

RH70969.pep Sequence

Translation from 2 to 307

> RH70969.pep
ELCAKLCKRRAKFCPPISVLSNSKFSQMESISSMIYLVAMMSLIIGGSQA
IPYRPSAYLYNQQYCMDTLTGRQLYIGEVFTREDQCVRIQCLETLQLWED
R*

RH70969.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20289-PA 165 GF20289-PA 1..73 28..100 228 58.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18386-PA 158 GG18386-PA 1..71 28..100 307 80.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17919-PA 164 GH17919-PA 1..76 28..101 206 51.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-PD 160 CG2081-PD 1..73 28..100 381 100 Plus
Vago-PB 160 CG2081-PB 1..73 28..100 381 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16062-PA 141 GI16062-PA 1..50 51..100 205 72 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18255-PA 162 GL18255-PA 5..74 30..100 246 60.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15228-PA 162 GA15228-PA 5..74 30..100 246 60.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11452-PA 160 GM11452-PA 1..73 28..100 346 90.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17004-PA 160 GD17004-PA 1..73 28..100 349 90.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15634-PA 148 GJ15634-PA 23..60 63..100 175 78.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15903-PA 158 GE15903-PA 1..73 28..100 334 84.9 Plus