Clone RH71704 Report

Search the DGRC for RH71704

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:717
Well:4
Vector:pFlc-1
Associated Gene/TranscriptEloC-RA
Protein status:RH71704.pep: gold
Preliminary Size:1222
Sequenced Size:561

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9291 2002-01-01 Sim4 clustering to Release 2
CG9291 2002-04-26 Blastp of sequenced clone
CG9291 2003-01-01 Sim4 clustering to Release 3
Elongin-C 2008-04-29 Release 5.5 accounting
Elongin-C 2008-08-15 Release 5.9 accounting
Elongin-C 2008-12-18 5.12 accounting

Clone Sequence Records

RH71704.complete Sequence

561 bp (561 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113630

> RH71704.complete
GATTGATTGTGTGTGTGTGTGCGTACCGTGCGGCGGTGTGTGGGTGTCAC
TGACTGATATTTGACAAATGATAGCAATGGACGAGCAGCGCGGCGACAAG
ATCTACGGCGGATGCGAGGGTCCGGACGCCATGTACGTGAAGCTGATTTC
CTCGGACGGCCACGAATTTGTCGTCAAACGCGAGCACGCTCTCACCTCCG
GCACAATCCGGGCGATGTTGTCCGGACCGGGTCAGTTTGCCGAGAACGAG
GCCAACGAGGTGCATTTCCGGGAGATACCATCCCACGTCCTACAAAAGGT
CTGCATGTACTTCACCTATAAAGTGCGTTACACCAACAGTTCTACCGAAA
TACCCGAATTCCCGATCGCTCCGGAGATCGCATTAGAACTTTTGATGGCG
GCTAATTTCCTAGACTGCTAAAGAAAATAATATTGGTTAATTTGAATTTA
CATTATTTACAAGTGAACGAAGAAGGGCCAGACTGCGTAAAGCTTAATTT
GCCCATGTTAATTTGGTAATAAAACGAGAAGATTGTCCCTGCGAGAAAAA
AAAAAAAAAAA

RH71704.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Elongin-C-RA 691 Elongin-C-RA 100..651 2..553 2745 99.8 Plus
Elongin-C-RB 675 Elongin-C-RB 151..636 68..553 2415 99.7 Plus
Elongin-C-RB 675 Elongin-C-RB 7..72 2..67 330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15332279..15332544 545..280 1330 100 Minus
chr2R 21145070 chr2R 15333093..15333304 279..68 1060 100 Minus
chr2R 21145070 chr2R 15333383..15333448 67..2 330 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19445106..19445379 553..280 1355 99.6 Minus
2R 25286936 2R 19445928..19446139 279..68 1060 100 Minus
2R 25286936 2R 19446218..19446283 67..2 330 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19446305..19446578 553..280 1355 99.6 Minus
2R 25260384 2R 19447127..19447338 279..68 1060 100 Minus
2R 25260384 2R 19447417..19447482 67..2 330 100 Minus
Blast to na_te.dros performed 2019-03-16 00:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 3074..3107 545..512 107 79.4 Minus

RH71704.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:22:34 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15332279..15332544 280..545 100 <- Minus
chr2R 15333093..15333304 68..279 100 <- Minus
chr2R 15333383..15333448 1..67 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:45 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RB 1..354 68..421 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:26 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RB 1..354 68..421 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:51:59 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RA 1..354 68..421 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:52 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RB 1..354 68..421 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:57:44 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
EloC-RA 1..354 68..421 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:33:11 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RA 1..537 9..545 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:26 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RA 8..553 1..545 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:51:59 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RA 2..547 1..545 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:53 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RA 1..537 9..545 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:57:44 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
EloC-RA 2..547 1..545 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:22:34 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19445114..19445379 280..545 100 <- Minus
2R 19445928..19446139 68..279 100 <- Minus
2R 19446218..19446283 1..67 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:22:34 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19445114..19445379 280..545 100 <- Minus
2R 19445928..19446139 68..279 100 <- Minus
2R 19446218..19446283 1..67 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:22:34 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19445114..19445379 280..545 100 <- Minus
2R 19445928..19446139 68..279 100 <- Minus
2R 19446218..19446283 1..67 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:51:59 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15332619..15332884 280..545 100 <- Minus
arm_2R 15333723..15333788 1..67 98   Minus
arm_2R 15333433..15333644 68..279 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:31 Download gff for RH71704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19446313..19446578 280..545 100 <- Minus
2R 19447127..19447338 68..279 100 <- Minus
2R 19447417..19447482 1..67 98   Minus

RH71704.pep Sequence

Translation from 67 to 420

> RH71704.pep
MIAMDEQRGDKIYGGCEGPDAMYVKLISSDGHEFVVKREHALTSGTIRAM
LSGPGQFAENEANEVHFREIPSHVLQKVCMYFTYKVRYTNSSTEIPEFPI
APEIALELLMAANFLDC*

RH71704.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12606-PA 117 GF12606-PA 1..117 1..117 629 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20907-PA 117 GG20907-PA 1..117 1..117 629 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20204-PA 117 GH20204-PA 1..117 1..117 619 97.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
EloC-PB 117 CG9291-PB 1..117 1..117 614 100 Plus
EloC-PA 117 CG9291-PA 1..117 1..117 614 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20730-PA 117 GI20730-PA 1..117 1..117 623 97.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16726-PA 117 GL16726-PA 1..117 1..117 619 97.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27687-PA 117 GA27687-PA 1..117 1..117 619 97.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19829-PA 114 GM19829-PA 1..114 4..117 614 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25320-PA 117 GD25320-PA 1..117 1..117 629 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20467-PA 117 GJ20467-PA 1..117 1..117 619 97.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15707-PA 114 GK15707-PA 1..114 4..117 605 97.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Elongin-C-PA 117 GE13845-PA 1..117 1..117 629 100 Plus

RH71704.hyp Sequence

Translation from 67 to 420

> RH71704.hyp
MIAMDEQRGDKIYGGCEGPDAMYVKLISSDGHEFVVKREHALTSGTIRAM
LSGPGQFAENEANEVHFREIPSHVLQKVCMYFTYKVRYTNSSTEIPEFPI
APEIALELLMAANFLDC*

RH71704.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
EloC-PB 117 CG9291-PB 1..117 1..117 614 100 Plus
EloC-PA 117 CG9291-PA 1..117 1..117 614 100 Plus