Clone RH72196 Report

Search the DGRC for RH72196

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:721
Well:96
Vector:pFlc-1
Associated Gene/TranscriptProsbeta4-RA
Protein status:RH72196.pep: gold
Preliminary Size:760
Sequenced Size:792

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17331 2002-01-01 Sim4 clustering to Release 2
CG17331 2002-04-26 Blastp of sequenced clone
CG17331 2003-01-01 Sim4 clustering to Release 3
CG17331 2008-04-29 Release 5.5 accounting
CG17331 2008-08-15 Release 5.9 accounting
CG17331 2008-12-18 5.12 accounting

Clone Sequence Records

RH72196.complete Sequence

792 bp (792 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113632

> RH72196.complete
GACTCTGCATTTAACTTGCTTGTCATCGCATTCGGCAACTCACAAACAAC
TTGTAATTTTCGTTAAAAAACCCCGAAAGTATAAATATAATTGCAACATG
GAGACTCTACTGGGTATCAAGGGCCCTGACTTCGTGATGCTGGCGGCGGA
CACCACCCACGCCCGATCCATTATAGTGATGAAAGAGGATCAGAACAAAA
TCCACAAGGTGTCGGATAGTCTGCTTATTTCAACCGTCGGCGAATCGGGC
GACACGGAGCAATTTACCGAATTCATTTCGAAGAACATAGCGTTGTACAA
GATGCGCAATGGCTACGATTTAAGTCCACGTGAATCGGCTCATTTTACTC
GCAAGAATCTGGCCGAATATCTTCGCAGTCGCACGCCCTACCAAGTGTTC
ATGTTTGTGGCCGGCTACGATCCCAACGCGGGTCCGGAGCTCACCTTCAT
TGACTATTTGGCCAATGCACTGCCTGTGAATTACGCCGGTCATGGCTATG
GTGCGATCTTCGCATCCAGCATCTATGACCGATACTGGCACCCCAATATA
ACCCAGGCGGAGGCCTACGACGTCTTCAAGAAGTGCATTGCCGAAATCCA
GAAGCGCCTGGTCGTCAACCTCAAGAACTTCACCGTCGCCGTCGTGGACA
AGGATGGTGTGCGAGATTTGGAGCCAATCAGCGCTGCTAGCCTGGCCGCT
TAGTTAGGTTTTGATTTAAGCATTTAAAATGCAGTTTTGTAATAAAATGC
GTCTGGATTCTTGGCTAATTTAAAAAGAAAAAAAAAAAAAAA

RH72196.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG17331-RA 921 CG17331-RA 34..805 2..773 3860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:53:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16729961..16730320 773..414 1785 99.7 Minus
chr2L 23010047 chr2L 16730385..16730611 414..188 1135 100 Minus
chr2L 23010047 chr2L 16730685..16730871 188..2 935 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16731219..16731578 773..414 1800 100 Minus
2L 23513712 2L 16731643..16731869 414..188 1135 100 Minus
2L 23513712 2L 16731943..16732129 188..2 935 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16731219..16731578 773..414 1800 100 Minus
2L 23513712 2L 16731643..16731869 414..188 1135 100 Minus
2L 23513712 2L 16731943..16732129 188..2 935 100 Minus
Blast to na_te.dros performed 2019-03-16 20:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
micropia 5461 micropia DMDM11 5461bp 2418..2479 707..767 108 69.8 Plus

RH72196.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:54:27 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16730685..16730871 1..188 99   Minus
chr2L 16729956..16730319 415..777 98 <- Minus
chr2L 16730385..16730610 189..414 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:48 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
CG17331-RA 1..606 98..703 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:10 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
CG17331-RA 1..606 98..703 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:42:12 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4-RA 1..606 98..703 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:40 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
CG17331-RA 1..606 98..703 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:58:26 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4-RA 1..606 98..703 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:48 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
CG17331-RA 1..774 2..777 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:10 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
CG17331-RA 1..770 2..771 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:42:12 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4-RB 4..778 1..777 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:40 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
CG17331-RA 1..774 2..777 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:58:26 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4-RB 4..778 1..777 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:54:27 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16731213..16731577 415..777 99 <- Minus
2L 16731643..16731868 189..414 100 <- Minus
2L 16731943..16732129 1..188 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:54:27 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16731213..16731577 415..777 99 <- Minus
2L 16731643..16731868 189..414 100 <- Minus
2L 16731943..16732129 1..188 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:54:27 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16731213..16731577 415..777 99 <- Minus
2L 16731643..16731868 189..414 100 <- Minus
2L 16731943..16732129 1..188 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:42:12 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16731943..16732129 1..188 99   Minus
arm_2L 16731213..16731577 415..777 99 <- Minus
arm_2L 16731643..16731868 189..414 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:15 Download gff for RH72196.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16731213..16731577 415..777 99 <- Minus
2L 16731643..16731868 189..414 100 <- Minus
2L 16731943..16732129 1..188 99   Minus

RH72196.hyp Sequence

Translation from 0 to 702

> RH72196.hyp
TLHLTCLSSHSATHKQLVIFVKKPRKYKYNCNMETLLGIKGPDFVMLAAD
TTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALYK
MRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFI
DYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQ
KRLVVNLKNFTVAVVDKDGVRDLEPISAASLAA*

RH72196.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta4-PB 201 CG17331-PB 1..201 33..233 1034 100 Plus
Prosbeta4-PA 201 CG17331-PA 1..201 33..233 1034 100 Plus
Prosbeta4R2-PB 210 CG17302-PB 3..201 33..231 609 55.3 Plus
Prosbeta4R2-PA 210 CG17302-PA 3..201 33..231 609 55.3 Plus
Prosbeta4R1-PA 215 CG17301-PA 1..199 33..231 489 43.2 Plus

RH72196.pep Sequence

Translation from 97 to 702

> RH72196.pep
METLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGES
GDTEQFTEFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQV
FMFVAGYDPNAGPELTFIDYLANALPVNYAGHGYGAIFASSIYDRYWHPN
ITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPISAASLA
A*

RH72196.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24340-PA 205 GF24340-PA 1..201 1..201 959 87.1 Plus
Dana\GF13881-PA 210 GF13881-PA 3..202 1..200 659 57 Plus
Dana\GF20768-PA 212 GF20768-PA 1..198 1..199 435 39.7 Plus
Dana\GF23798-PA 272 GF23798-PA 42..240 4..192 146 24.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20111-PA 201 GG20111-PA 1..201 1..201 1053 97.5 Plus
Dere\GG24870-PA 210 GG24870-PA 3..201 1..199 647 56.3 Plus
Dere\GG24868-PA 215 GG24868-PA 1..201 1..201 547 45.3 Plus
Dere\GG18789-PA 307 GG18789-PA 50..241 3..198 165 24 Plus
Dere\GG15711-PA 272 GG15711-PA 42..240 4..192 143 23.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11559-PA 206 GH11559-PA 1..199 1..199 925 83.9 Plus
Dgri\GH22171-PA 222 GH22171-PA 1..201 1..201 632 53.2 Plus
Dgri\GH11159-PA 222 GH11159-PA 1..201 1..201 631 53.2 Plus
Dgri\GH11158-PA 397 GH11158-PA 1..118 44..161 202 32.2 Plus
Dgri\GH16666-PA 272 GH16666-PA 42..220 4..186 152 25.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta4-PB 201 CG17331-PB 1..201 1..201 1034 100 Plus
Prosbeta4-PA 201 CG17331-PA 1..201 1..201 1034 100 Plus
Prosbeta4R2-PB 210 CG17302-PB 3..201 1..199 609 55.3 Plus
Prosbeta4R2-PA 210 CG17302-PA 3..201 1..199 609 55.3 Plus
Prosbeta4R1-PA 215 CG17301-PA 1..199 1..199 489 43.2 Plus
Prosbeta2-PA 272 CG3329-PA 41..240 3..192 145 23.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17050-PA 206 GI17050-PA 1..199 1..199 891 80.4 Plus
Dmoj\GI17870-PA 221 GI17870-PA 1..201 1..201 638 54.7 Plus
Dmoj\GI17867-PA 214 GI17867-PA 1..192 1..192 404 37 Plus
Dmoj\GI15360-PA 313 GI15360-PA 46..237 3..198 168 24 Plus
Dmoj\GI11352-PA 270 GI11352-PA 41..220 3..186 143 25 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19338-PA 214 GL19338-PA 1..207 1..199 891 81.2 Plus
Dper\GL26572-PA 210 GL26572-PA 3..201 1..199 655 58.3 Plus
Dper\GL27233-PA 208 GL27233-PA 1..200 1..199 401 37.5 Plus
Dper\GL24711-PA 272 GL24711-PA 42..222 4..188 152 24.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14463-PA 206 GA14463-PA 1..199 1..199 949 87.4 Plus
Dpse\GA28985-PA 210 GA28985-PA 3..201 1..199 655 58.3 Plus
Dpse\GA26779-PA 208 GA26779-PA 1..200 1..199 400 37 Plus
Dpse\GA17382-PA 272 GA17382-PA 42..222 4..188 151 24.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17161-PA 201 GM17161-PA 1..201 1..201 1056 98 Plus
Dsec\GM18354-PA 210 GM18354-PA 3..201 1..199 636 55.3 Plus
Dsec\GM18352-PA 211 GM18352-PA 1..199 1..199 490 41.2 Plus
Dsec\GM12440-PA 307 GM12440-PA 50..230 3..187 146 23.8 Plus
Dsec\GM25498-PA 272 GM25498-PA 42..240 4..192 145 23.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21900-PA 201 GD21900-PA 1..201 1..201 1058 98 Plus
Dsim\GD23168-PA 210 GD23168-PA 3..201 1..199 636 55.3 Plus
Dsim\GD23166-PA 211 GD23166-PA 1..199 1..199 502 42.7 Plus
Dsim\GD16756-PA 307 GD16756-PA 50..230 3..187 146 23.8 Plus
Dsim\GD14518-PA 272 GD14518-PA 42..240 4..192 145 23.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17300-PA 206 GJ17300-PA 1..199 1..199 913 82.9 Plus
Dvir\GJ17367-PA 231 GJ17367-PA 1..201 1..201 537 46.8 Plus
Dvir\GJ17369-PA 193 GJ17369-PA 3..173 31..201 525 52 Plus
Dvir\GJ11606-PA 270 GJ11606-PA 40..237 4..191 145 26 Plus
Dvir\GJ16628-PA 304 GJ16628-PA 46..237 3..198 143 23 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15122-PA 207 GK15122-PA 1..200 1..200 973 88.5 Plus
Dwil\GK24489-PA 210 GK24489-PA 3..201 1..199 678 59.3 Plus
Dwil\GK24488-PA 212 GK24488-PA 7..200 2..195 432 38.7 Plus
Dwil\GK10550-PA 272 GK10550-PA 41..240 3..192 153 24.8 Plus
Dwil\GK25153-PA 353 GK25153-PA 52..211 3..165 147 24.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13168-PA 201 GE13168-PA 1..201 1..201 1053 97.5 Plus
Dyak\GE18168-PA 210 GE18168-PA 3..201 1..199 642 55.8 Plus
Dyak\GE18166-PA 215 GE18166-PA 1..201 1..201 539 44.3 Plus
Dyak\GE14876-PA 1119 GE14876-PA 1043..1105 129..191 307 87.3 Plus
Dyak\GE14911-PA 314 GE14911-PA 4..76 114..186 293 74 Plus