BDGP Sequence Production Resources |
Search the DGRC for RH72196
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 721 |
Well: | 96 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Prosbeta4-RA |
Protein status: | RH72196.pep: gold |
Preliminary Size: | 760 |
Sequenced Size: | 792 |
Gene | Date | Evidence |
---|---|---|
CG17331 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17331 | 2002-04-26 | Blastp of sequenced clone |
CG17331 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17331 | 2008-04-29 | Release 5.5 accounting |
CG17331 | 2008-08-15 | Release 5.9 accounting |
CG17331 | 2008-12-18 | 5.12 accounting |
792 bp (792 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113632
> RH72196.complete GACTCTGCATTTAACTTGCTTGTCATCGCATTCGGCAACTCACAAACAAC TTGTAATTTTCGTTAAAAAACCCCGAAAGTATAAATATAATTGCAACATG GAGACTCTACTGGGTATCAAGGGCCCTGACTTCGTGATGCTGGCGGCGGA CACCACCCACGCCCGATCCATTATAGTGATGAAAGAGGATCAGAACAAAA TCCACAAGGTGTCGGATAGTCTGCTTATTTCAACCGTCGGCGAATCGGGC GACACGGAGCAATTTACCGAATTCATTTCGAAGAACATAGCGTTGTACAA GATGCGCAATGGCTACGATTTAAGTCCACGTGAATCGGCTCATTTTACTC GCAAGAATCTGGCCGAATATCTTCGCAGTCGCACGCCCTACCAAGTGTTC ATGTTTGTGGCCGGCTACGATCCCAACGCGGGTCCGGAGCTCACCTTCAT TGACTATTTGGCCAATGCACTGCCTGTGAATTACGCCGGTCATGGCTATG GTGCGATCTTCGCATCCAGCATCTATGACCGATACTGGCACCCCAATATA ACCCAGGCGGAGGCCTACGACGTCTTCAAGAAGTGCATTGCCGAAATCCA GAAGCGCCTGGTCGTCAACCTCAAGAACTTCACCGTCGCCGTCGTGGACA AGGATGGTGTGCGAGATTTGGAGCCAATCAGCGCTGCTAGCCTGGCCGCT TAGTTAGGTTTTGATTTAAGCATTTAAAATGCAGTTTTGTAATAAAATGC GTCTGGATTCTTGGCTAATTTAAAAAGAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17331-RA | 921 | CG17331-RA | 34..805 | 2..773 | 3860 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 16729961..16730320 | 773..414 | 1785 | 99.7 | Minus |
chr2L | 23010047 | chr2L | 16730385..16730611 | 414..188 | 1135 | 100 | Minus |
chr2L | 23010047 | chr2L | 16730685..16730871 | 188..2 | 935 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 16731219..16731578 | 773..414 | 1800 | 100 | Minus |
2L | 23513712 | 2L | 16731643..16731869 | 414..188 | 1135 | 100 | Minus |
2L | 23513712 | 2L | 16731943..16732129 | 188..2 | 935 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 16731219..16731578 | 773..414 | 1800 | 100 | Minus |
2L | 23513712 | 2L | 16731643..16731869 | 414..188 | 1135 | 100 | Minus |
2L | 23513712 | 2L | 16731943..16732129 | 188..2 | 935 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
micropia | 5461 | micropia DMDM11 5461bp | 2418..2479 | 707..767 | 108 | 69.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 16730685..16730871 | 1..188 | 99 | Minus | |
chr2L | 16729956..16730319 | 415..777 | 98 | <- | Minus |
chr2L | 16730385..16730610 | 189..414 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17331-RA | 1..606 | 98..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17331-RA | 1..606 | 98..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Prosbeta4-RA | 1..606 | 98..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17331-RA | 1..606 | 98..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Prosbeta4-RA | 1..606 | 98..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17331-RA | 1..774 | 2..777 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17331-RA | 1..770 | 2..771 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Prosbeta4-RB | 4..778 | 1..777 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17331-RA | 1..774 | 2..777 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Prosbeta4-RB | 4..778 | 1..777 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16731213..16731577 | 415..777 | 99 | <- | Minus |
2L | 16731643..16731868 | 189..414 | 100 | <- | Minus |
2L | 16731943..16732129 | 1..188 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16731213..16731577 | 415..777 | 99 | <- | Minus |
2L | 16731643..16731868 | 189..414 | 100 | <- | Minus |
2L | 16731943..16732129 | 1..188 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16731213..16731577 | 415..777 | 99 | <- | Minus |
2L | 16731643..16731868 | 189..414 | 100 | <- | Minus |
2L | 16731943..16732129 | 1..188 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 16731943..16732129 | 1..188 | 99 | Minus | |
arm_2L | 16731213..16731577 | 415..777 | 99 | <- | Minus |
arm_2L | 16731643..16731868 | 189..414 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16731213..16731577 | 415..777 | 99 | <- | Minus |
2L | 16731643..16731868 | 189..414 | 100 | <- | Minus |
2L | 16731943..16732129 | 1..188 | 99 | Minus |
Translation from 0 to 702
> RH72196.hyp TLHLTCLSSHSATHKQLVIFVKKPRKYKYNCNMETLLGIKGPDFVMLAAD TTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALYK MRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFI DYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQ KRLVVNLKNFTVAVVDKDGVRDLEPISAASLAA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Prosbeta4-PB | 201 | CG17331-PB | 1..201 | 33..233 | 1034 | 100 | Plus |
Prosbeta4-PA | 201 | CG17331-PA | 1..201 | 33..233 | 1034 | 100 | Plus |
Prosbeta4R2-PB | 210 | CG17302-PB | 3..201 | 33..231 | 609 | 55.3 | Plus |
Prosbeta4R2-PA | 210 | CG17302-PA | 3..201 | 33..231 | 609 | 55.3 | Plus |
Prosbeta4R1-PA | 215 | CG17301-PA | 1..199 | 33..231 | 489 | 43.2 | Plus |
Translation from 97 to 702
> RH72196.pep METLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGES GDTEQFTEFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQV FMFVAGYDPNAGPELTFIDYLANALPVNYAGHGYGAIFASSIYDRYWHPN ITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPISAASLA A*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24340-PA | 205 | GF24340-PA | 1..201 | 1..201 | 959 | 87.1 | Plus |
Dana\GF13881-PA | 210 | GF13881-PA | 3..202 | 1..200 | 659 | 57 | Plus |
Dana\GF20768-PA | 212 | GF20768-PA | 1..198 | 1..199 | 435 | 39.7 | Plus |
Dana\GF23798-PA | 272 | GF23798-PA | 42..240 | 4..192 | 146 | 24.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20111-PA | 201 | GG20111-PA | 1..201 | 1..201 | 1053 | 97.5 | Plus |
Dere\GG24870-PA | 210 | GG24870-PA | 3..201 | 1..199 | 647 | 56.3 | Plus |
Dere\GG24868-PA | 215 | GG24868-PA | 1..201 | 1..201 | 547 | 45.3 | Plus |
Dere\GG18789-PA | 307 | GG18789-PA | 50..241 | 3..198 | 165 | 24 | Plus |
Dere\GG15711-PA | 272 | GG15711-PA | 42..240 | 4..192 | 143 | 23.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11559-PA | 206 | GH11559-PA | 1..199 | 1..199 | 925 | 83.9 | Plus |
Dgri\GH22171-PA | 222 | GH22171-PA | 1..201 | 1..201 | 632 | 53.2 | Plus |
Dgri\GH11159-PA | 222 | GH11159-PA | 1..201 | 1..201 | 631 | 53.2 | Plus |
Dgri\GH11158-PA | 397 | GH11158-PA | 1..118 | 44..161 | 202 | 32.2 | Plus |
Dgri\GH16666-PA | 272 | GH16666-PA | 42..220 | 4..186 | 152 | 25.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Prosbeta4-PB | 201 | CG17331-PB | 1..201 | 1..201 | 1034 | 100 | Plus |
Prosbeta4-PA | 201 | CG17331-PA | 1..201 | 1..201 | 1034 | 100 | Plus |
Prosbeta4R2-PB | 210 | CG17302-PB | 3..201 | 1..199 | 609 | 55.3 | Plus |
Prosbeta4R2-PA | 210 | CG17302-PA | 3..201 | 1..199 | 609 | 55.3 | Plus |
Prosbeta4R1-PA | 215 | CG17301-PA | 1..199 | 1..199 | 489 | 43.2 | Plus |
Prosbeta2-PA | 272 | CG3329-PA | 41..240 | 3..192 | 145 | 23.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17050-PA | 206 | GI17050-PA | 1..199 | 1..199 | 891 | 80.4 | Plus |
Dmoj\GI17870-PA | 221 | GI17870-PA | 1..201 | 1..201 | 638 | 54.7 | Plus |
Dmoj\GI17867-PA | 214 | GI17867-PA | 1..192 | 1..192 | 404 | 37 | Plus |
Dmoj\GI15360-PA | 313 | GI15360-PA | 46..237 | 3..198 | 168 | 24 | Plus |
Dmoj\GI11352-PA | 270 | GI11352-PA | 41..220 | 3..186 | 143 | 25 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19338-PA | 214 | GL19338-PA | 1..207 | 1..199 | 891 | 81.2 | Plus |
Dper\GL26572-PA | 210 | GL26572-PA | 3..201 | 1..199 | 655 | 58.3 | Plus |
Dper\GL27233-PA | 208 | GL27233-PA | 1..200 | 1..199 | 401 | 37.5 | Plus |
Dper\GL24711-PA | 272 | GL24711-PA | 42..222 | 4..188 | 152 | 24.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14463-PA | 206 | GA14463-PA | 1..199 | 1..199 | 949 | 87.4 | Plus |
Dpse\GA28985-PA | 210 | GA28985-PA | 3..201 | 1..199 | 655 | 58.3 | Plus |
Dpse\GA26779-PA | 208 | GA26779-PA | 1..200 | 1..199 | 400 | 37 | Plus |
Dpse\GA17382-PA | 272 | GA17382-PA | 42..222 | 4..188 | 151 | 24.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17161-PA | 201 | GM17161-PA | 1..201 | 1..201 | 1056 | 98 | Plus |
Dsec\GM18354-PA | 210 | GM18354-PA | 3..201 | 1..199 | 636 | 55.3 | Plus |
Dsec\GM18352-PA | 211 | GM18352-PA | 1..199 | 1..199 | 490 | 41.2 | Plus |
Dsec\GM12440-PA | 307 | GM12440-PA | 50..230 | 3..187 | 146 | 23.8 | Plus |
Dsec\GM25498-PA | 272 | GM25498-PA | 42..240 | 4..192 | 145 | 23.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21900-PA | 201 | GD21900-PA | 1..201 | 1..201 | 1058 | 98 | Plus |
Dsim\GD23168-PA | 210 | GD23168-PA | 3..201 | 1..199 | 636 | 55.3 | Plus |
Dsim\GD23166-PA | 211 | GD23166-PA | 1..199 | 1..199 | 502 | 42.7 | Plus |
Dsim\GD16756-PA | 307 | GD16756-PA | 50..230 | 3..187 | 146 | 23.8 | Plus |
Dsim\GD14518-PA | 272 | GD14518-PA | 42..240 | 4..192 | 145 | 23.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17300-PA | 206 | GJ17300-PA | 1..199 | 1..199 | 913 | 82.9 | Plus |
Dvir\GJ17367-PA | 231 | GJ17367-PA | 1..201 | 1..201 | 537 | 46.8 | Plus |
Dvir\GJ17369-PA | 193 | GJ17369-PA | 3..173 | 31..201 | 525 | 52 | Plus |
Dvir\GJ11606-PA | 270 | GJ11606-PA | 40..237 | 4..191 | 145 | 26 | Plus |
Dvir\GJ16628-PA | 304 | GJ16628-PA | 46..237 | 3..198 | 143 | 23 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15122-PA | 207 | GK15122-PA | 1..200 | 1..200 | 973 | 88.5 | Plus |
Dwil\GK24489-PA | 210 | GK24489-PA | 3..201 | 1..199 | 678 | 59.3 | Plus |
Dwil\GK24488-PA | 212 | GK24488-PA | 7..200 | 2..195 | 432 | 38.7 | Plus |
Dwil\GK10550-PA | 272 | GK10550-PA | 41..240 | 3..192 | 153 | 24.8 | Plus |
Dwil\GK25153-PA | 353 | GK25153-PA | 52..211 | 3..165 | 147 | 24.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13168-PA | 201 | GE13168-PA | 1..201 | 1..201 | 1053 | 97.5 | Plus |
Dyak\GE18168-PA | 210 | GE18168-PA | 3..201 | 1..199 | 642 | 55.8 | Plus |
Dyak\GE18166-PA | 215 | GE18166-PA | 1..201 | 1..201 | 539 | 44.3 | Plus |
Dyak\GE14876-PA | 1119 | GE14876-PA | 1043..1105 | 129..191 | 307 | 87.3 | Plus |
Dyak\GE14911-PA | 314 | GE14911-PA | 4..76 | 114..186 | 293 | 74 | Plus |