Clone RH72336 Report

Search the DGRC for RH72336

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:723
Well:36
Vector:pFlc-1
Associated Gene/TranscriptVps2-RA
Protein status:RH72336.pep: gold
Preliminary Size:771
Sequenced Size:1176

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14542 2003-01-01 Sim4 clustering to Release 3
CG14542 2003-02-13 Blastp of sequenced clone
CG14542 2008-04-29 Release 5.5 accounting
CG14542 2008-08-15 Release 5.9 accounting
CG14542 2008-12-18 5.12 accounting

Clone Sequence Records

RH72336.complete Sequence

1176 bp (1176 high quality bases) assembled on 2003-02-13

GenBank Submission: BT003747

> RH72336.complete
GACCCTTCGCTTATTGTTTTGGTTGATGAGTAATCTTTAGGAAACTCCGT
CATTCTTCGTAATTAAATCTTGCAGTTAAGATATCCTTAAACATGGACTG
GCTATTCGGCAAGAAGATCAGCCCCGATGAGATGCTGCGTAAGAATCAGC
GGGCGCTCAACAAAGCGATGCGAGATCTGGACCGCGAGCGGATGAAAATG
GAGCAGCAGGAGAAGAAGATTATCGCGGATATCAAGAAGATGGCCAAGGA
GGGTCAAATGGATGCCGTGAAGATCATGGCCAAGGATCTGGTGCGCACGC
GGCGGTATGCCAAGAAGTTCATGCTGATGAAGGCAAACATCCAGGCGGTG
TCCCTCAAAATTCAGACGCTCAAGTCGCAGAACACAATGGCACAGGCCAT
GAAAGGTGTCACGAAGGCCATGCAGAACATGAACCGCCAGCTGAATCTCC
CGCAAATCCAGAAGATCCTGCAGGACTTCGAGAAACAGTCGGAAATGATG
GACATGAAGGAGGAGATGATCAACGATGCCATCGATGACGCCATGGAGGA
CGAGGGCGACGAGGAGGAGACGGATGCTGTTGTGTCCCAGGTGCTGGACG
AACTGGGTCTGCAATTGGGCGAACAGCTGGGAGACCTTCCTTCCGCCTCC
GGTTCCCTTTCCATAGCCGGCGGCGCTGGCGCTCAGAAAGCACAGGCTGT
GGCCGCTGGTGGCGTTGGCGGCGGTGGAGCCGCCGGCGGAGGTGGAGCTA
GTGGTGGCGGCGCTGGTGGTCCGGGAGCTCCCGGTGGCAGTGGTGCCTCA
TCGCCCATGTCCGATGCCGATGCGGATCTTCAGGCGCGCCTGGATAAGCT
GCGCAAGGATTGAGCCGCTACTAAGAACCACTGCCTGTCCACTTTATGTA
AGAGCCACCACCCGTTTGTATCTCCCAGAAGCGAATTTTATATTAAAGAG
AATGCTTGTGATTTTCGTTCCCTGCGTGTTTGAAAAATCGATGAGTAATT
AGCATTTACAAGCTATAATGGAAAGAACTGGGTAGTGCTGCAATCGCACA
GCCTAGCTACAAACAAATTCGCAATACTTGTTACTTTAGAGCTATACAAT
ATTCGGTATTTTAAAAGATATGTACGTTTCATGCCTGTCTTCAATAAAAT
AAGAAAAAGGAAAAAAAAAAAAAAAA

RH72336.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG14542-RA 1376 CG14542-RA 129..1289 2..1162 5790 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21876274..21877030 404..1160 3740 99.6 Plus
chr3R 27901430 chr3R 21875812..21876217 2..407 2030 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26053288..26054046 404..1162 3780 99.9 Plus
3R 32079331 3R 26052826..26053231 2..407 2030 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25794119..25794877 404..1162 3780 99.8 Plus
3R 31820162 3R 25793657..25794062 2..407 2030 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:01:08 has no hits.

RH72336.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:01:57 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21876276..21876576 406..706 100 == Plus
chr3R 21875811..21876215 1..405 99 -> Plus
chr3R 21876666..21877030 796..1160 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:49 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
CG14542-RA 1..771 93..863 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:08 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
vps2-RA 1..771 93..863 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:04:45 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
vps2-RA 1..771 93..863 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:31:06 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
CG14542-RA 1..771 93..863 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:56:41 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
Vps2-RA 1..771 93..863 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:59:23 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
CG14542-RA 2..1160 2..1160 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:07 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
vps2-RA 2..1160 2..1160 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:45 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
vps2-RA 5..1164 1..1160 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:06 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
CG14542-RA 2..1160 2..1160 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:56:41 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
Vps2-RA 5..1164 1..1160 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:01:57 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26052825..26053229 1..405 99 -> Plus
3R 26053290..26054044 406..1160 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:01:57 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26052825..26053229 1..405 99 -> Plus
3R 26053290..26054044 406..1160 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:01:57 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26052825..26053229 1..405 99 -> Plus
3R 26053290..26054044 406..1160 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:45 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21878547..21878951 1..405 99 -> Plus
arm_3R 21879012..21879766 406..1160 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:09:58 Download gff for RH72336.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25793656..25794060 1..405 99 -> Plus
3R 25794121..25794875 406..1160 99   Plus

RH72336.pep Sequence

Translation from 92 to 862

> RH72336.pep
MDWLFGKKISPDEMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKM
AKEGQMDAVKIMAKDLVRTRRYAKKFMLMKANIQAVSLKIQTLKSQNTMA
QAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEMMDMKEEMINDAIDDA
MEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPSASGSLSIAGGAGAQKA
QAVAAGGVGGGGAAGGGGASGGGAGGPGAPGGSGASSPMSDADADLQARL
DKLRKD*

RH72336.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16804-PA 252 GF16804-PA 1..252 1..256 935 91.4 Plus
Dana\GF23969-PA 212 GF23969-PA 2..195 1..193 272 36.1 Plus
Dana\GF10809-PA 203 GF10809-PA 13..189 22..201 179 27.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11461-PA 256 GG11461-PA 1..256 1..256 1283 99.6 Plus
Dere\GG15261-PA 212 GG15261-PA 2..188 1..188 265 36.7 Plus
Dere\GG15729-PA 203 GG15729-PA 43..189 52..201 158 27.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19462-PA 259 GH19462-PA 1..259 1..256 959 89.6 Plus
Dgri\GH16177-PA 212 GH16177-PA 2..188 1..188 258 37.2 Plus
Dgri\GH17196-PA 203 GH17196-PA 45..187 54..201 166 30.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
Vps2-PA 256 CG14542-PA 1..256 1..256 1275 100 Plus
CHMP2B-PA 212 CG4618-PA 5..200 4..199 349 34.7 Plus
Chmp1-PB 203 CG4108-PB 6..189 15..201 237 28.3 Plus
Chmp1-PA 203 CG4108-PA 6..189 15..201 237 28.3 Plus
Vps24-PB 223 CG9779-PB 3..181 4..183 195 25.8 Plus
Vps24-PA 223 CG9779-PA 3..181 4..183 195 25.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24696-PA 253 GI24696-PA 1..253 1..256 972 90.2 Plus
Dmoj\GI13330-PA 212 GI13330-PA 2..195 1..193 278 36.1 Plus
Dmoj\GI11307-PA 203 GI11307-PA 6..187 15..201 167 30.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21825-PA 256 GL21825-PA 1..256 1..256 988 91.8 Plus
Dper\GL22617-PA 212 GL22617-PA 2..188 1..188 273 37.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13067-PA 256 GA13067-PA 1..256 1..256 986 92.2 Plus
Dpse\GA18306-PA 212 GA18306-PA 2..188 1..188 273 37.2 Plus
Dpse\GA17963-PA 204 GA17963-PA 43..188 52..201 160 29.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10303-PA 256 GM10303-PA 1..256 1..256 1275 98.8 Plus
Dsec\GM14695-PA 212 GM14695-PA 2..188 1..188 261 36.2 Plus
Dsec\GM14926-PA 203 GM14926-PA 43..189 52..201 158 27.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21266-PA 256 GD21266-PA 1..256 1..256 1277 99.2 Plus
Dsim\GD12332-PA 203 GD12332-PA 43..189 52..201 158 27.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23912-PA 251 GJ23912-PA 1..251 1..256 930 89.8 Plus
Dvir\GJ13157-PA 212 GJ13157-PA 2..200 1..199 324 34.7 Plus
Dvir\GJ14099-PA 203 GJ14099-PA 43..187 52..201 160 29.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:51:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14462-PA 251 GK14462-PA 1..251 1..256 969 90.2 Plus
Dwil\GK20320-PA 213 GK20320-PA 2..204 1..204 355 37.3 Plus
Dwil\GK10775-PA 203 GK10775-PA 43..189 52..201 157 27.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23653-PA 256 GE23653-PA 1..256 1..256 1271 98.4 Plus
Dyak\GE21483-PA 212 GE21483-PA 2..184 1..183 256 35 Plus
Dyak\Chmp1-PA 203 GE22062-PA 43..189 52..201 163 28 Plus

RH72336.hyp Sequence

Translation from 92 to 862

> RH72336.hyp
MDWLFGKKISPDEMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKM
AKEGQMDAVKIMAKDLVRTRRYAKKFMLMKANIQAVSLKIQTLKSQNTMA
QAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEMMDMKEEMINDAIDDA
MEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPSASGSLSIAGGAGAQKA
QAVAAGGVGGGGAAGGGGASGGGAGGPGAPGGSGASSPMSDADADLQARL
DKLRKD*

RH72336.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
Vps2-PA 256 CG14542-PA 1..256 1..256 1275 100 Plus
CHMP2B-PA 212 CG4618-PA 5..200 4..199 349 34.7 Plus
Chmp1-PB 203 CG4108-PB 6..189 15..201 237 28.3 Plus
Chmp1-PA 203 CG4108-PA 6..189 15..201 237 28.3 Plus
Vps24-PA 223 CG9779-PA 3..181 4..183 195 25.8 Plus