Clone RH72992 Report

Search the DGRC for RH72992

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:729
Well:92
Vector:pFlc-1
Associated Gene/TranscriptCys-RA
Protein status:RH72992.pep: gold
Preliminary Size:523
Sequenced Size:465

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8050 2002-01-01 Sim4 clustering to Release 2
CG8050 2002-04-26 Blastp of sequenced clone
Cys 2008-04-29 Release 5.5 accounting
Cys 2008-08-15 Release 5.9 accounting
Cys 2008-12-18 5.12 accounting

Clone Sequence Records

RH72992.complete Sequence

465 bp (465 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113633

> RH72992.complete
GATCAGTTCTCTCAGAGTCGTCGAGCGAGCAACATGAACGTAGTAAAATC
TTTGTGTATTTTGGGTCTGGTTCTCGTCAGCTTGATTGCCACCCAAGCAG
CCGATGAGCAGGTGGTAGGCGGTGTCAGCCAGTTGGAGGGAAACAGCAGG
AAGGAGGCTCTGGAACTTCTGGATGCCACTCTCGCACAGTTGGCCACCGG
AGATGGTCCCAGCTACAAGGCAATCAATGTGACCTCTGTGACGGGTCAGG
TCGTAGCTGGAAGTCTTAACACCTACGAGGTGGAACTTGACAATGGATCC
GACAAAAAGCAGTGCACCGTGAAGATCTGGACTCAGCCATGGCTCAAGGA
GAACGGCACCAACATCAAGATCAAGTGCTCTGGTGACGATGGCGAACTGG
ACCGCACCTGGTAGAAGATTCTTCGTGAGAATTGCCCTGAAAGAAATAAT
AATAAAAAAAAAAAA

RH72992.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Cys-RA 553 Cys-RA 2..464 2..464 2315 100 Plus
CG8066-RA 1239 CG8066-RA 146..445 115..417 875 86.4 Plus
CG8066.a 1404 CG8066.a 311..610 115..417 875 86.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10393887..10394121 453..219 1175 100 Minus
chr3R 27901430 chr3R 10394179..10394396 219..2 1090 100 Minus
chr3R 27901430 chr3R 10393160..10393355 417..219 555 86.4 Minus
chr3R 27901430 chr3R 10393419..10393523 219..115 315 86.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14569120..14569365 464..219 1230 100 Minus
3R 32079331 3R 14569423..14569640 219..2 1090 100 Minus
3R 32079331 3R 14568404..14568599 417..219 555 86.4 Minus
3R 32079331 3R 14568663..14568767 219..115 315 86.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14309951..14310196 464..219 1230 100 Minus
3R 31820162 3R 14310254..14310471 219..2 1090 100 Minus
3R 31820162 3R 14309235..14309430 417..219 565 86.4 Minus
3R 31820162 3R 14309494..14309598 219..115 315 86.6 Minus
Blast to na_te.dros performed on 2019-03-16 13:32:17 has no hits.

RH72992.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:33:11 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10393897..10394121 219..443 100 <- Minus
chr3R 10394180..10394396 1..218 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:53 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
Cys-RA 1..381 34..414 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:11 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
Cys-RA 1..381 34..414 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:34 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
Cys-RA 1..381 34..414 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:41 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
Cys-RA 1..381 34..414 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:20:56 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
Cys-RA 1..381 34..414 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:50 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
Cys-RA 2..453 2..453 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:11 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
Cys-RA 2..453 2..453 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:34 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
Cys-RA 4..456 1..453 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:41 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
Cys-RA 2..453 2..453 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:56 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
Cys-RA 4..456 1..453 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:11 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14569131..14569365 219..453 100 <- Minus
3R 14569424..14569640 1..218 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:11 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14569131..14569365 219..453 100 <- Minus
3R 14569424..14569640 1..218 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:11 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14569131..14569365 219..453 100 <- Minus
3R 14569424..14569640 1..218 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:34 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10394853..10395087 219..453 100 <- Minus
arm_3R 10395146..10395362 1..218 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:16 Download gff for RH72992.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14309962..14310196 219..453 100 <- Minus
3R 14310255..14310471 1..218 99   Minus

RH72992.hyp Sequence

Translation from 3 to 413

> RH72992.hyp
QFSQSRRASNMNVVKSLCILGLVLVSLIATQAADEQVVGGVSQLEGNSRK
EALELLDATLAQLATGDGPSYKAINVTSVTGQVVAGSLNTYEVELDNGSD
KKQCTVKIWTQPWLKENGTNIKIKCSGDDGELDRTW*

RH72992.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
Cys-PA 126 CG8050-PA 1..126 11..136 643 100 Plus
CG8066-PB 104 CG8066-PB 6..104 37..136 414 81 Plus
CG8066-PA 104 CG8066-PA 6..104 37..136 414 81 Plus
CG31313-PB 124 CG31313-PB 1..124 14..136 284 44.8 Plus
CG31313-PA 124 CG31313-PA 1..124 14..136 284 44.8 Plus

RH72992.pep Sequence

Translation from 33 to 413

> RH72992.pep
MNVVKSLCILGLVLVSLIATQAADEQVVGGVSQLEGNSRKEALELLDATL
AQLATGDGPSYKAINVTSVTGQVVAGSLNTYEVELDNGSDKKQCTVKIWT
QPWLKENGTNIKIKCSGDDGELDRTW*

RH72992.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17475-PA 119 GF17475-PA 21..119 27..126 285 53 Plus
Dana\GF17474-PA 94 GF17474-PA 2..94 23..126 280 59.6 Plus
Dana\GF17473-PA 134 GF17473-PA 20..124 23..126 244 45.3 Plus
Dana\GF15461-PA 125 GF15461-PA 26..116 28..118 162 40.2 Plus
Dana\GF16067-PA 620 GF16067-PA 203..277 40..115 150 40.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21208-PA 126 GG21208-PA 1..126 1..126 569 87.3 Plus
Dere\GG21219-PA 105 GG21219-PA 6..105 27..126 443 84 Plus
Dere\GG21229-PA 124 GG21229-PA 1..124 1..126 299 48.4 Plus
Dere\GG18301-PA 122 GG18301-PA 7..113 12..118 184 39.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14129-PA 122 GH14129-PA 4..122 9..126 328 56.3 Plus
Dgri\GH14130-PA 132 GH14130-PA 3..132 2..126 284 45.4 Plus
Dgri\GH14128-PA 107 GH14128-PA 5..107 24..126 256 53.4 Plus
Dgri\GH14131-PA 120 GH14131-PA 1..116 1..124 193 36.3 Plus
Dgri\GH17753-PA 124 GH17753-PA 1..116 1..118 166 40.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Cys-PA 126 CG8050-PA 1..126 1..126 643 100 Plus
CG8066-PB 104 CG8066-PB 6..104 27..126 414 81 Plus
CG8066-PA 104 CG8066-PA 6..104 27..126 414 81 Plus
CG31313-PB 124 CG31313-PB 1..124 4..126 284 44.8 Plus
CG31313-PA 124 CG31313-PA 1..124 4..126 284 44.8 Plus
CG15369-PB 122 CG15369-PB 7..113 12..118 179 38 Plus
CG15369-PA 122 CG15369-PA 7..113 12..118 179 38 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10659-PA 124 GI10659-PA 6..124 9..126 269 48.7 Plus
Dmoj\GI10664-PA 116 GI10664-PA 1..112 4..124 232 44.6 Plus
Dmoj\GI10658-PA 109 GI10658-PA 5..109 24..126 223 46.7 Plus
Dmoj\GI10663-PA 119 GI10663-PA 4..113 10..122 221 42.5 Plus
Dmoj\GI10660-PA 119 GI10660-PA 4..108 10..115 221 43.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24171-PA 127 GL24171-PA 1..127 1..126 463 70.9 Plus
Dper\GL24172-PA 122 GL24172-PA 1..122 1..126 362 57 Plus
Dper\GL26833-PA 137 GL26833-PA 36..126 28..118 152 41.9 Plus
Dper\GL22196-PA 627 GL22196-PA 206..282 40..115 150 38.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20790-PA 127 GA20790-PA 1..127 1..126 459 70.1 Plus
Dpse\GA26524-PA 122 GA26524-PA 1..122 1..126 363 57 Plus
Dpse\GA13677-PA 137 GA13677-PA 36..126 28..118 154 41.9 Plus
Dpse\GA27408-PB 477 GA27408-PB 56..132 40..115 150 39.7 Plus
Dpse\GA27408-PA 629 GA27408-PA 208..284 40..115 150 38.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25841-PA 123 GM25841-PA 1..123 1..126 550 86.5 Plus
Dsec\GM26669-PA 123 GM26669-PA 1..123 1..126 540 84.9 Plus
Dsec\GM26670-PA 105 GM26670-PA 6..105 27..126 481 91 Plus
Dsec\GM25842-PA 105 GM25842-PA 6..105 27..126 449 85 Plus
Dsec\GM25833-PA 124 GM25833-PA 1..124 4..126 276 44.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20412-PA 123 GD20412-PA 1..123 1..126 566 88.1 Plus
Dsim\GD20413-PA 105 GD20413-PA 6..105 27..126 447 84 Plus
Dsim\GD20414-PA 124 GD20414-PA 1..124 4..126 291 47.2 Plus
Dsim\GD16941-PA 122 GD16941-PA 7..118 12..124 186 40.4 Plus
Dsim\GD19635-PA 359 GD19635-PA 202..272 46..115 137 36.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23017-PA 126 GJ23017-PA 9..126 7..126 335 57.5 Plus
Dvir\GJ23015-PA 110 GJ23015-PA 6..110 24..126 266 52.4 Plus
Dvir\GJ19267-PA 122 GJ19267-PA 21..113 26..118 191 43.6 Plus
Dvir\GJ11017-PA 599 GJ11017-PA 181..257 40..116 164 42.3 Plus
Dvir\GJ23016-PA 165 GJ23016-PA 42..120 42..121 151 46.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11350-PA 124 GK11350-PA 8..124 12..126 423 70.9 Plus
Dwil\GK11742-PA 128 GK11742-PA 1..128 1..126 345 55.5 Plus
Dwil\GK11349-PA 106 GK11349-PA 2..106 22..126 284 52.4 Plus
Dwil\GK11352-PA 120 GK11352-PA 1..112 1..118 248 45.4 Plus
Dwil\GK25384-PA 129 GK25384-PA 1..114 1..116 179 40.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Cys-PA 123 GE26440-PA 1..123 1..126 539 84.9 Plus
Dyak\GE26441-PA 105 GE26441-PA 6..105 27..126 449 84 Plus
Dyak\GE26442-PA 124 GE26442-PA 1..124 1..126 287 46.1 Plus