Clone RH73327 Report

Search the DGRC for RH73327

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:733
Well:27
Vector:pFlc-1
Associated Gene/TranscriptCG1598-RA
Protein status:RH73327.pep: gold
Preliminary Size:1225
Sequenced Size:1275

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1598 2002-01-01 Sim4 clustering to Release 2
CG1598 2002-04-26 Blastp of sequenced clone
CG1600 2003-01-01 Sim4 clustering to Release 3
CG1598 2008-04-29 Release 5.5 accounting
CG1598 2008-08-15 Release 5.9 accounting
CG1598 2008-12-18 5.12 accounting

Clone Sequence Records

RH73327.complete Sequence

1275 bp (1275 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113636

> RH73327.complete
ATTGATACTAAAAACGGTCACTCTGCACGCCAGAAGTCATATTCATTGCT
TATAAGCAATTATTAATTTCAACTAATTTCATACGTGTCTCGCTTTAGTG
GGCATTATGGCCGACAATTTGGAGCCCCTGGAGCCCAGCCTGCAGAATCT
CGTCGAGCAGGACTCCCTCAAGTGGATCTTCGTGGGCGGAAAAGGCGGCG
TGGGCAAGACGACTTGCAGTTCTAGCCTAGCCGTTCAGCTGTCGAAAGTG
CGCGAATCCGTGCTAATCATATCCACAGATCCGGCGCACAACATATCGGA
TGCATTCGATCAGAAGTTCACCAAGGTGCCGACAAAGGTAAATGGCTTTG
ACAACCTGTTCGCCATGGAAATCGATCCAAATGCCGGTCTCAACGAGCTG
CCCGAGGAGTACTTCGATGGCGAAAATGAGGCGCTGCGCGTGAGCAAGGG
CGTCATGCAGGAGATGATCAACGCCCTGCCCGGCATCGACGAGGCGATGA
GCTATGCAGAGGTTATGAAGCTGGTCAAGGGCATGAACTTCTCGGTAGTC
GTCTTCGACACGGCGCCCACGGGACACACGCTGCGTCTGATTGCATTTCC
CCAGGTGGTGGAGAAGGGGCTGGGCAAGCTGCTGCGGCTCAAGATGAAGG
TGGCGCCCCTGCTGTCACAGTTCGTCTCCATGCTGGGCATGGCTGATGTG
AACGCTGACACACTCTCCCAGAAGCTGGACGACATGCTGCGCGTTATCAC
CCAGGTCAACGAGCAGTTCAAGAACCCAGATCAAACTACATTCGTCTGCG
TGTGCATAGCAGAGTTCTTCTCGCTGTACGAGACGGAACGACTTGTGCAA
GAGCTAACCAAGTGCGGCATCGACGTCCACAACATCATTGTAAACCAACT
GCTGTTTCTGCAGAACTCGCACGACTCGTGCAGCATGTGCGCCTCCCGCT
TCAAGATTCAGGAGAAGTACCTGGACCAGATTGCCGACCTGTATGAAGAC
TTCCACGTAACCAAGTTGCCGCTCCTCGAGAAAGAGGTGCGCGGTCCAGA
GAGCATCCGTTCTTTCTCCGAGAACCTTATGAAGCCCTACAACCCCAAGG
GCGAGCCCAAGGAATAGGATAGCCCGTCCAACCCTTTACCCATCCGTTTG
TAAGTTTCTTCCTTAGTTTGTGTGAACAGAAAGTGCGTAAAATAAATTAA
AGTTGAGGCAGCGATCCCCGAAGGGATCTGCTTCGACGTGTAATGCGTAG
ACAACGCTTAAAAAAAAAAAAAAAA

RH73327.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG1598-RA 1411 CG1598-RA 139..1395 5..1261 6285 100 Plus
CG2137-RA 2379 CG2137-RA 2312..2379 1261..1194 340 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3425581..3426061 1259..779 2405 100 Minus
chr2R 21145070 chr2R 3426120..3426563 779..336 2205 99.8 Minus
chr2R 21145070 chr2R 3426827..3427041 219..5 1075 100 Minus
chr2R 21145070 chr2R 3426644..3426765 339..218 610 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7538230..7538712 1261..779 2415 100 Minus
2R 25286936 2R 7538771..7539214 779..336 2220 100 Minus
2R 25286936 2R 7539478..7539692 219..5 1075 100 Minus
2R 25286936 2R 7539295..7539416 339..218 610 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7539429..7539911 1261..779 2415 100 Minus
2R 25260384 2R 7539970..7540413 779..336 2220 100 Minus
2R 25260384 2R 7540677..7540891 219..5 1075 100 Minus
2R 25260384 2R 7540494..7540615 339..218 610 100 Minus
Blast to na_te.dros performed 2019-03-16 20:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 1648..1732 27..116 114 62.2 Plus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 10166..10250 27..116 114 62.2 Plus

RH73327.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:09:09 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3426827..3427045 1..219 99   Minus
chr2R 3425581..3426061 779..1259 100 <- Minus
chr2R 3426121..3426561 338..778 99 <- Minus
chr2R 3426646..3426763 220..337 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:57 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
CG1598-RA 1..1011 107..1117 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:15 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
CG1598-RA 1..1011 107..1117 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:45 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
CG1598-RA 1..1011 107..1117 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:44 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
CG1598-RA 1..1011 107..1117 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:00 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
CG1598-RA 1..1011 107..1117 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:55 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
CG1598-RA 2..1259 3..1259 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:15 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
CG1598-RA 2..1259 3..1259 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:45 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
CG1598-RA 2..1259 3..1259 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:44 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
CG1598-RA 2..1259 3..1259 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:00 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
CG1598-RA 2..1259 3..1259 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:09 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7538232..7538712 779..1259 100 <- Minus
2R 7538772..7539212 338..778 100 <- Minus
2R 7539297..7539414 220..337 100 <- Minus
2R 7539478..7539696 1..219 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:09 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7538232..7538712 779..1259 100 <- Minus
2R 7538772..7539212 338..778 100 <- Minus
2R 7539297..7539414 220..337 100 <- Minus
2R 7539478..7539696 1..219 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:09 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7538232..7538712 779..1259 100 <- Minus
2R 7538772..7539212 338..778 100 <- Minus
2R 7539297..7539414 220..337 100 <- Minus
2R 7539478..7539696 1..219 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:45 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3426983..3427201 1..219 99   Minus
arm_2R 3425737..3426217 779..1259 100 <- Minus
arm_2R 3426277..3426717 338..778 100 <- Minus
arm_2R 3426802..3426919 220..337 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:20 Download gff for RH73327.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7539431..7539911 779..1259 100 <- Minus
2R 7539971..7540411 338..778 100 <- Minus
2R 7540496..7540613 220..337 100 <- Minus
2R 7540677..7540895 1..219 99   Minus

RH73327.pep Sequence

Translation from 106 to 1116

> RH73327.pep
MADNLEPLEPSLQNLVEQDSLKWIFVGGKGGVGKTTCSSSLAVQLSKVRE
SVLIISTDPAHNISDAFDQKFTKVPTKVNGFDNLFAMEIDPNAGLNELPE
EYFDGENEALRVSKGVMQEMINALPGIDEAMSYAEVMKLVKGMNFSVVVF
DTAPTGHTLRLIAFPQVVEKGLGKLLRLKMKVAPLLSQFVSMLGMADVNA
DTLSQKLDDMLRVITQVNEQFKNPDQTTFVCVCIAEFFSLYETERLVQEL
TKCGIDVHNIIVNQLLFLQNSHDSCSMCASRFKIQEKYLDQIADLYEDFH
VTKLPLLEKEVRGPESIRSFSENLMKPYNPKGEPKE*

RH73327.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11712-PA 336 GF11712-PA 1..336 1..336 1748 96.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10733-PA 336 GG10733-PA 1..336 1..336 1762 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21552-PA 336 GH21552-PA 1..331 1..331 1621 94.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG1598-PA 336 CG1598-PA 1..336 1..336 1719 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19524-PA 332 GI19524-PA 1..331 1..331 1693 96.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20106-PA 336 GL20106-PA 1..336 1..336 1626 94 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14038-PA 336 GA14038-PA 1..336 1..336 1628 93.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20779-PA 335 GM20779-PA 1..335 1..336 1612 94.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10240-PA 336 GD10240-PA 1..336 1..336 1772 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21093-PA 336 GJ21093-PA 1..331 1..331 1615 95.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17805-PA 335 GK17805-PA 6..328 5..330 1512 90.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23838-PA 336 GE23838-PA 1..336 1..336 1761 98.2 Plus

RH73327.hyp Sequence

Translation from 106 to 1116

> RH73327.hyp
MADNLEPLEPSLQNLVEQDSLKWIFVGGKGGVGKTTCSSSLAVQLSKVRE
SVLIISTDPAHNISDAFDQKFTKVPTKVNGFDNLFAMEIDPNAGLNELPE
EYFDGENEALRVSKGVMQEMINALPGIDEAMSYAEVMKLVKGMNFSVVVF
DTAPTGHTLRLIAFPQVVEKGLGKLLRLKMKVAPLLSQFVSMLGMADVNA
DTLSQKLDDMLRVITQVNEQFKNPDQTTFVCVCIAEFFSLYETERLVQEL
TKCGIDVHNIIVNQLLFLQNSHDSCSMCASRFKIQEKYLDQIADLYEDFH
VTKLPLLEKEVRGPESIRSFSENLMKPYNPKGEPKE*

RH73327.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG1598-PA 336 CG1598-PA 1..336 1..336 1719 100 Plus