Clone RH73529 Report

Search the DGRC for RH73529

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:735
Well:29
Vector:pFlc-1
Associated Gene/TranscriptLSm7-RA
Protein status:RH73529.pep: gold
Preliminary Size:653
Sequenced Size:712

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13277 2002-01-01 Sim4 clustering to Release 2
CG13277 2002-04-26 Blastp of sequenced clone
CG13277 2003-01-01 Sim4 clustering to Release 3
CG13277 2008-04-29 Release 5.5 accounting
CG13277 2008-08-15 Release 5.9 accounting
CG13277 2008-12-18 5.12 accounting

Clone Sequence Records

RH73529.complete Sequence

712 bp (712 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113637

> RH73529.complete
GACCAGCCGGCATTTACCAAAAACAGAATAATGGCAGATAAAAAGGTGGG
TGGCAACAATGACGGTAAGGAGAAGCGCCGCAAGGAGTCCATTCTGGACC
TCTCCAAGTACTTGGAGAAACAGATCCGCGTGAAATTCGCGGGCGGCCGC
GAGGCATCCGGAATCCTCAAGGGCTACGATGCGCTGCTCAATCTGGTGCT
GGACAACACGGTGGAGTATCTGCGCGACTCGGATGAGCCCTACAAACTGA
CCGAGGAGCAGACCCGCAGCCTGGGACTGGTCGTCTGTCGCGGCACAGCC
CTCGTCCTCATTTGTCCGCAAGACGGAGTCGAGAGCATCGCCAATCCGTT
TATAACGCAATAGTCCAAGGTTTTGTGGCTGGGATGCGTTCCAGAATGTA
GACTAAGTACAAAGCTCTTTTGGAAATCGGTTTAAATATATTTAGCGGAG
ACATACATACGTATAAATTAGTTCTTAAAATCTAATCAGGCCGCAAAGTA
CCACGTTTATGAGCCCGCGAAATTGTTTAAGCTTCTCCATAAAATTCAGA
GTGTTCCGATTTTAAATTAATGCACTTTATCCTCTTCAGGTATGTTACGA
AGTTATCTACGGGTTTGCTTACGGTCAGATTTTGAAAGCTGAATCATCTA
AATATGCGTAATCCAATTTATAAATATTAATTTTTCTAAACAATTAAAAA
AAAAAAAAAAAA

RH73529.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
LSm7-RA 842 LSm7-RA 55..752 2..699 3490 100 Plus
LSm7.c 659 LSm7.c 55..462 2..409 2040 100 Plus
LSm7.a 653 LSm7.a 55..453 2..400 1995 100 Plus
LSm7.c 659 LSm7.c 460..569 590..699 550 100 Plus
LSm7.a 653 LSm7.a 451..560 590..699 550 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16741078..16741729 695..44 3260 100 Minus
chr2L 23010047 chr2L 16741785..16741830 47..2 230 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16742333..16742988 699..44 3280 100 Minus
2L 23513712 2L 16743044..16743089 47..2 230 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16742333..16742988 699..44 3280 100 Minus
2L 23513712 2L 16743044..16743089 47..2 230 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:32:25 has no hits.

RH73529.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:33:16 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16741113..16741727 46..660 100 <- Minus
chr2L 16741787..16741830 1..45 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:58 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
CG13277-RA 1..333 31..363 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:17 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 1..333 31..363 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:43 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 1..333 31..363 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:45 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
CG13277-RA 1..333 31..363 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:10 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 1..333 31..363 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:58 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
CG13277-RA 1..694 2..695 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:16 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 1..694 2..695 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:43 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 11..705 1..695 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:45 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
CG13277-RA 1..694 2..695 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:10 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 11..705 1..695 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:16 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16742337..16742986 46..695 100 <- Minus
2L 16743046..16743089 1..45 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:16 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16742337..16742986 46..695 100 <- Minus
2L 16743046..16743089 1..45 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:16 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16742337..16742986 46..695 100 <- Minus
2L 16743046..16743089 1..45 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:43 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16743046..16743089 1..45 97   Minus
arm_2L 16742337..16742986 46..695 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:21 Download gff for RH73529.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16742337..16742986 46..695 100 <- Minus
2L 16743046..16743089 1..45 97   Minus

RH73529.hyp Sequence

Translation from 3 to 362

> RH73529.hyp
QPAFTKNRIMADKKVGGNNDGKEKRRKESILDLSKYLEKQIRVKFAGGRE
ASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTAL
VLICPQDGVESIANPFITQ*

RH73529.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
LSm7-PB 110 CG13277-PB 1..110 10..119 557 100 Plus
LSm7-PC 110 CG13277-PC 1..110 10..119 557 100 Plus
LSm7-PA 110 CG13277-PA 1..110 10..119 557 100 Plus
SmG-PB 76 CG9742-PB 8..76 32..109 142 35.9 Plus
SmG-PA 76 CG9742-PA 8..76 32..109 142 35.9 Plus

RH73529.pep Sequence

Translation from 30 to 362

> RH73529.pep
MADKKVGGNNDGKEKRRKESILDLSKYLEKQIRVKFAGGREASGILKGYD
ALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVLICPQDGV
ESIANPFITQ*

RH73529.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14546-PA 110 GF14546-PA 1..110 1..110 557 97.3 Plus
Dana\GF21254-PA 101 GF21254-PA 25..95 15..94 145 36.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20109-PA 110 GG20109-PA 1..110 1..110 567 100 Plus
Dere\GG18240-PA 76 GG18240-PA 8..76 23..100 145 37.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10206-PA 113 GH10206-PA 1..110 1..110 555 97.3 Plus
Dgri\GH12097-PA 76 GH12097-PA 8..76 23..100 147 37.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
LSm7-PB 110 CG13277-PB 1..110 1..110 557 100 Plus
LSm7-PC 110 CG13277-PC 1..110 1..110 557 100 Plus
LSm7-PA 110 CG13277-PA 1..110 1..110 557 100 Plus
SNRPG-PB 76 CG9742-PB 8..76 23..100 142 35.9 Plus
SNRPG-PA 76 CG9742-PA 8..76 23..100 142 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14941-PA 110 GI14941-PA 1..110 1..110 554 97.3 Plus
Dmoj\GI11102-PA 76 GI11102-PA 8..76 23..100 148 38.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19334-PA 110 GL19334-PA 1..110 1..110 548 96.4 Plus
Dper\GL24044-PA 76 GL24044-PA 8..76 23..100 143 37.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12164-PA 110 GA12164-PA 1..110 1..110 548 96.4 Plus
Dpse\GA26490-PA 76 GA26490-PA 8..76 23..100 143 37.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17159-PA 110 GM17159-PA 1..110 1..110 567 100 Plus
Dsec\GM13382-PA 76 GM13382-PA 8..76 23..100 142 35.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21898-PA 110 GD21898-PA 1..110 1..110 567 100 Plus
Dsim\GD15738-PA 76 GD15738-PA 8..76 23..100 142 35.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24083-PA 110 GJ24083-PA 1..110 1..110 554 97.3 Plus
Dvir\GJ15956-PA 76 GJ15956-PA 8..76 23..100 148 38.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18159-PA 110 GK18159-PA 1..110 1..110 539 95.5 Plus
Dwil\GK25208-PA 76 GK25208-PA 8..76 23..100 143 35.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13166-PA 110 GE13166-PA 1..110 1..110 567 100 Plus
Dyak\GE15956-PA 76 GE15956-PA 8..76 23..100 145 37.2 Plus