Clone RH73723 Report

Search the DGRC for RH73723

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:737
Well:23
Vector:pFlc-1
Associated Gene/TranscriptmRpS34-RA
Protein status:RH73723.pep: gold
Sequenced Size:690

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpS34 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

RH73723.complete Sequence

690 bp assembled on 2009-08-06

GenBank Submission: BT099501.1

> RH73723.complete
GACTGTTTTTATAACTTGCAACAAAAATTCAATTAAAATAGTGAAATAAC
CCAGTAAAATGGCCCAAAAAGTGATCAAGTACATCGGTCGCACCACAGAC
TTTCGCGGCAACACGCTGTGGGAGCTGGTCTCAAACCTGCCCAACTGGGG
TGTGGGCCGTCTGCTAATACGTAACATGTTCCAGCGATATCCGGAGCCCT
GCTACATGCGGATTCTGAAGGTGCAGTCCGTGGACGAGCAGCCCGGCGAG
ATCCGCAAGGTGCGGGTCACTGTGGAGAAAACGTGGCGCGGCGTAACGCA
GCCAAAGCCTGTGGAAATCTACAGCACCAGCTATAAGGCGGACTACGAAC
TGGTGCCGCAGGATCAGGAAGCAAAGTATCTGAACAACAAGAAGAAGGTT
GAACCAGTGATACTGCCCACCAAGATTGAACTTCCGCCTCTGCTCCGCGA
ACTGGTATCGGAGGAAACGGGCAACCCCAATCCCCAGATGAAGGTCCACT
ACAAACTGACCGACAACAAAATGGCCAGATTAGCCAAGGATGGAGAAAAG
CCAACTGTTAACTTTGCCCTTGGTGTGGGCCAGCCGAAACCCGTGAGCGC
CAAGCTTTACGAAGGATTATTATAAGCCTGGGGACGTTGTTGAAATATTA
AATACATATATTATACACTTAAACAAAAAAAAAAAAAAAA

RH73723.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS34-RA 682 mRpS34-RA 14..682 2..670 3345 100 Plus
CG4925-RA 2562 CG4925-RA 2512..2562 675..625 255 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16337871..16338543 2..674 3320 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16348110..16348783 2..675 3370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16341210..16341883 2..675 3370 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:04:39 has no hits.

RH73723.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:05:19 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16337870..16338543 1..674 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:59 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS34-RA 1..567 59..625 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:56:49 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS34-RA 1..567 59..625 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:01:40 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS34-RA 1..567 59..625 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:11 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS34-RA 1..567 59..625 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-06 12:49:06 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS34-RA 13..680 1..668 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:56:48 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS34-RA 13..680 1..668 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:01:40 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS34-RA 36..709 1..674 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:11 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS34-RA 36..709 1..674 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:05:19 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16348109..16348782 1..674 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:05:19 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16348109..16348782 1..674 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:05:19 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16348109..16348782 1..674 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:01:40 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16341209..16341882 1..674 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:21 Download gff for RH73723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16341209..16341882 1..674 99   Plus

RH73723.pep Sequence

Translation from 58 to 624

> RH73723.pep
MAQKVIKYIGRTTDFRGNTLWELVSNLPNWGVGRLLIRNMFQRYPEPCYM
RILKVQSVDEQPGEIRKVRVTVEKTWRGVTQPKPVEIYSTSYKADYELVP
QDQEAKYLNNKKKVEPVILPTKIELPPLLRELVSEETGNPNPQMKVHYKL
TDNKMARLAKDGEKPTVNFALGVGQPKPVSAKLYEGLL*

RH73723.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10114-PA 188 GF10114-PA 1..188 1..188 881 87.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15996-PA 188 GG15996-PA 1..188 1..188 925 92.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15885-PA 188 GH15885-PA 1..188 1..188 780 74.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS34-PA 188 CG13037-PA 1..188 1..188 987 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16536-PA 188 GI16536-PA 1..188 1..188 787 76.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17855-PA 188 GL17855-PA 1..188 1..188 815 80.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11991-PA 188 GA11991-PA 1..188 1..188 815 80.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25627-PA 188 GM25627-PA 1..188 1..188 953 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14631-PA 188 GD14631-PA 1..188 1..188 971 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12788-PA 188 GJ12788-PA 1..188 1..188 779 76.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13981-PA 188 GK13981-PA 1..188 1..188 759 73.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19560-PA 188 GE19560-PA 1..188 1..188 930 92 Plus
Dyak\GE23182-PA 175 GE23182-PA 1..162 1..162 816 93.2 Plus

RH73723.hyp Sequence

Translation from 58 to 624

> RH73723.hyp
MAQKVIKYIGRTTDFRGNTLWELVSNLPNWGVGRLLIRNMFQRYPEPCYM
RILKVQSVDEQPGEIRKVRVTVEKTWRGVTQPKPVEIYSTSYKADYELVP
QDQEAKYLNNKKKVEPVILPTKIELPPLLRELVSEETGNPNPQMKVHYKL
TDNKMARLAKDGEKPTVNFALGVGQPKPVSAKLYEGLL*

RH73723.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS34-PA 188 CG13037-PA 1..188 1..188 987 100 Plus