BDGP Sequence Production Resources |
Search the DGRC for RH73723
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 737 |
Well: | 23 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpS34-RA |
Protein status: | RH73723.pep: gold |
Sequenced Size: | 690 |
Gene | Date | Evidence |
---|---|---|
mRpS34 | 2009-06-08 | Manual selection by Joe Carlson |
690 bp assembled on 2009-08-06
GenBank Submission: BT099501.1
> RH73723.complete GACTGTTTTTATAACTTGCAACAAAAATTCAATTAAAATAGTGAAATAAC CCAGTAAAATGGCCCAAAAAGTGATCAAGTACATCGGTCGCACCACAGAC TTTCGCGGCAACACGCTGTGGGAGCTGGTCTCAAACCTGCCCAACTGGGG TGTGGGCCGTCTGCTAATACGTAACATGTTCCAGCGATATCCGGAGCCCT GCTACATGCGGATTCTGAAGGTGCAGTCCGTGGACGAGCAGCCCGGCGAG ATCCGCAAGGTGCGGGTCACTGTGGAGAAAACGTGGCGCGGCGTAACGCA GCCAAAGCCTGTGGAAATCTACAGCACCAGCTATAAGGCGGACTACGAAC TGGTGCCGCAGGATCAGGAAGCAAAGTATCTGAACAACAAGAAGAAGGTT GAACCAGTGATACTGCCCACCAAGATTGAACTTCCGCCTCTGCTCCGCGA ACTGGTATCGGAGGAAACGGGCAACCCCAATCCCCAGATGAAGGTCCACT ACAAACTGACCGACAACAAAATGGCCAGATTAGCCAAGGATGGAGAAAAG CCAACTGTTAACTTTGCCCTTGGTGTGGGCCAGCCGAAACCCGTGAGCGC CAAGCTTTACGAAGGATTATTATAAGCCTGGGGACGTTGTTGAAATATTA AATACATATATTATACACTTAAACAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 16337871..16338543 | 2..674 | 3320 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 16348110..16348783 | 2..675 | 3370 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 16341210..16341883 | 2..675 | 3370 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16337870..16338543 | 1..674 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS34-RA | 1..567 | 59..625 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS34-RA | 1..567 | 59..625 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS34-RA | 1..567 | 59..625 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS34-RA | 1..567 | 59..625 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS34-RA | 13..680 | 1..668 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS34-RA | 13..680 | 1..668 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS34-RA | 36..709 | 1..674 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS34-RA | 36..709 | 1..674 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16348109..16348782 | 1..674 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16348109..16348782 | 1..674 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16348109..16348782 | 1..674 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16341209..16341882 | 1..674 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16341209..16341882 | 1..674 | 99 | Plus |
Translation from 58 to 624
> RH73723.pep MAQKVIKYIGRTTDFRGNTLWELVSNLPNWGVGRLLIRNMFQRYPEPCYM RILKVQSVDEQPGEIRKVRVTVEKTWRGVTQPKPVEIYSTSYKADYELVP QDQEAKYLNNKKKVEPVILPTKIELPPLLRELVSEETGNPNPQMKVHYKL TDNKMARLAKDGEKPTVNFALGVGQPKPVSAKLYEGLL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10114-PA | 188 | GF10114-PA | 1..188 | 1..188 | 881 | 87.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15996-PA | 188 | GG15996-PA | 1..188 | 1..188 | 925 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15885-PA | 188 | GH15885-PA | 1..188 | 1..188 | 780 | 74.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS34-PA | 188 | CG13037-PA | 1..188 | 1..188 | 987 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16536-PA | 188 | GI16536-PA | 1..188 | 1..188 | 787 | 76.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17855-PA | 188 | GL17855-PA | 1..188 | 1..188 | 815 | 80.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11991-PA | 188 | GA11991-PA | 1..188 | 1..188 | 815 | 80.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25627-PA | 188 | GM25627-PA | 1..188 | 1..188 | 953 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14631-PA | 188 | GD14631-PA | 1..188 | 1..188 | 971 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12788-PA | 188 | GJ12788-PA | 1..188 | 1..188 | 779 | 76.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13981-PA | 188 | GK13981-PA | 1..188 | 1..188 | 759 | 73.9 | Plus |
Translation from 58 to 624
> RH73723.hyp MAQKVIKYIGRTTDFRGNTLWELVSNLPNWGVGRLLIRNMFQRYPEPCYM RILKVQSVDEQPGEIRKVRVTVEKTWRGVTQPKPVEIYSTSYKADYELVP QDQEAKYLNNKKKVEPVILPTKIELPPLLRELVSEETGNPNPQMKVHYKL TDNKMARLAKDGEKPTVNFALGVGQPKPVSAKLYEGLL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS34-PA | 188 | CG13037-PA | 1..188 | 1..188 | 987 | 100 | Plus |