Clone RH73910 Report

Search the DGRC for RH73910

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:739
Well:10
Vector:pFlc-1
Associated Gene/TranscriptCG18619-RB
Protein status:RH73910.pep: gold
Preliminary Size:486
Sequenced Size:522

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18619 2002-01-01 Sim4 clustering to Release 2
CG18619 2002-04-26 Blastp of sequenced clone
CG18619 2003-01-01 Sim4 clustering to Release 3
CG18619 2008-04-29 Release 5.5 accounting
CG18619 2008-08-15 Release 5.9 accounting
CG18619 2008-12-18 5.12 accounting

Clone Sequence Records

RH73910.complete Sequence

522 bp (522 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113639

> RH73910.complete
GATTGTTACCTTGAGTATTTACGAAAGACGCATAATAACAAAGAGTTGCA
AAGTTGTTGTATTATTTGAGAGTTATAATGGCTGATATGGAGATACAGAG
CAACAAAATGTCAATAACGGAGGAAACACAAGTGACGCGCAAGGAATGTG
GAAAAAGGGGACGAAAACCAGGAAGAAAGACGTCTACTGAAAAATTGGAC
ATGAAAGCCAAACTAGAACGCAGCAGACAAAGTGCCAGGGAATGCCGGGC
GCGCAAGAAGCTGCGGTATCAGTACCTGGAGGAACTGGTGGCGGATCGGG
AGAAGGCTGTAGTTGCTTTGCGTACGGAACTGGAGCGCTTAATTCAATGG
AATAACCAGTTGAGCGAAAGCAACACTCCAACCAACAATGACCAGTTACT
TCAGGAACTCGGAATCCTCAAACAAGAATAACCTACATTCTTATTTTTAG
CTTAAGAATATTACTTTTATAATAAATGTACGACGGTTACTATTTATATT
ATTATGAAAAAAAAAAAAAAAA

RH73910.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-RB 671 CG18619-RB 52..560 2..510 2530 99.8 Plus
CG18619-RA 712 CG18619-RA 52..563 2..510 2475 99.2 Plus
CG18619-RC 713 CG18619-RC 52..564 2..510 2465 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10263803..10263968 339..504 830 100 Plus
chr2L 23010047 chr2L 10262988..10263120 2..134 665 100 Plus
chr2L 23010047 chr2L 10263618..10263741 215..338 620 100 Plus
chr2L 23010047 chr2L 10263407..10263489 134..216 415 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10264947..10265118 339..510 845 99.4 Plus
2L 23513712 2L 10264132..10264264 2..134 665 100 Plus
2L 23513712 2L 10264762..10264885 215..338 620 100 Plus
2L 23513712 2L 10264551..10264633 134..216 415 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10264947..10265118 339..510 845 99.4 Plus
2L 23513712 2L 10264132..10264264 2..134 665 100 Plus
2L 23513712 2L 10264762..10264885 215..338 620 100 Plus
2L 23513712 2L 10264551..10264633 134..216 415 100 Plus
Blast to na_te.dros performed 2019-03-15 14:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
Burdock 6411 Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). 5561..5615 501..446 106 67.9 Minus

RH73910.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:37:44 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10263803..10263970 339..506 99   Plus
chr2L 10263620..10263741 217..338 100 -> Plus
chr2L 10262987..10263120 1..134 99 -> Plus
chr2L 10263408..10263489 135..216 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:54:06 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 1..354 78..431 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:19 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 1..354 78..431 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:37:04 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 1..354 78..431 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:47 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 1..354 78..431 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:45 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 1..354 78..431 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:33:02 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 2..506 2..506 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:19 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 2..506 2..506 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:37:04 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 7..512 1..506 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:47 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 2..506 2..506 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:45 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 7..512 1..506 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:37:44 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264131..10264264 1..134 99 -> Plus
2L 10264552..10264633 135..216 100 -> Plus
2L 10264764..10264885 217..338 100 -> Plus
2L 10264947..10265114 339..506 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:37:44 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264131..10264264 1..134 99 -> Plus
2L 10264552..10264633 135..216 100 -> Plus
2L 10264764..10264885 217..338 100 -> Plus
2L 10264947..10265114 339..506 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:37:44 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264131..10264264 1..134 99 -> Plus
2L 10264552..10264633 135..216 100 -> Plus
2L 10264764..10264885 217..338 100 -> Plus
2L 10264947..10265114 339..506 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:37:04 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10264764..10264885 217..338 100 -> Plus
arm_2L 10264131..10264264 1..134 99 -> Plus
arm_2L 10264552..10264633 135..216 100 -> Plus
arm_2L 10264947..10265114 339..506 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:24 Download gff for RH73910.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264131..10264264 1..134 99 -> Plus
2L 10264552..10264633 135..216 100 -> Plus
2L 10264764..10264885 217..338 100 -> Plus
2L 10264947..10265114 339..506 99   Plus

RH73910.pep Sequence

Translation from 77 to 430

> RH73910.pep
MADMEIQSNKMSITEETQVTRKECGKRGRKPGRKTSTEKLDMKAKLERSR
QSARECRARKKLRYQYLEELVADREKAVVALRTELERLIQWNNQLSESNT
PTNNDQLLQELGILKQE*

RH73910.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15758-PA 93 GF15758-PA 1..89 1..89 401 87.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10098-PA 117 GG10098-PA 1..117 1..117 585 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13018-PA 118 GH13018-PA 1..115 4..117 442 74.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
REPTOR-BP-PB 117 CG18619-PB 1..117 1..117 586 100 Plus
REPTOR-BP-PA 118 CG18619-PA 1..118 1..117 574 99.2 Plus
REPTOR-BP-PC 93 CG18619-PC 1..89 1..89 435 97.8 Plus
REPTOR-BP-PD 94 CG18619-PD 1..90 1..89 423 96.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18265-PA 118 GI18265-PA 1..115 4..117 424 72.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19008-PA 115 GL19008-PA 1..115 4..117 438 75.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15016-PA 108 GA15016-PA 1..108 11..117 416 75.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18070-PA 94 GM18070-PA 1..90 1..89 418 93.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23670-PA 94 GD23670-PA 1..90 1..89 419 93.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17525-PA 118 GJ17525-PA 1..115 4..117 433 73 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23539-PA 111 GK23539-PA 1..108 11..117 388 71.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18912-PA 117 GE18912-PA 1..117 1..117 584 97.4 Plus

RH73910.hyp Sequence

Translation from 77 to 430

> RH73910.hyp
MADMEIQSNKMSITEETQVTRKECGKRGRKPGRKTSTEKLDMKAKLERSR
QSARECRARKKLRYQYLEELVADREKAVVALRTELERLIQWNNQLSESNT
PTNNDQLLQELGILKQE*

RH73910.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-PB 117 CG18619-PB 1..117 1..117 586 100 Plus
CG18619-PA 118 CG18619-PA 1..118 1..117 574 99.2 Plus
CG18619-PC 93 CG18619-PC 1..89 1..89 435 97.8 Plus
CG18619-PD 94 CG18619-PD 1..90 1..89 423 96.7 Plus