![]() | BDGP Sequence Production Resources |
Search the DGRC for RH73910
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 739 |
Well: | 10 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG18619-RB |
Protein status: | RH73910.pep: gold |
Preliminary Size: | 486 |
Sequenced Size: | 522 |
Gene | Date | Evidence |
---|---|---|
CG18619 | 2002-01-01 | Sim4 clustering to Release 2 |
CG18619 | 2002-04-26 | Blastp of sequenced clone |
CG18619 | 2003-01-01 | Sim4 clustering to Release 3 |
CG18619 | 2008-04-29 | Release 5.5 accounting |
CG18619 | 2008-08-15 | Release 5.9 accounting |
CG18619 | 2008-12-18 | 5.12 accounting |
522 bp (522 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113639
> RH73910.complete GATTGTTACCTTGAGTATTTACGAAAGACGCATAATAACAAAGAGTTGCA AAGTTGTTGTATTATTTGAGAGTTATAATGGCTGATATGGAGATACAGAG CAACAAAATGTCAATAACGGAGGAAACACAAGTGACGCGCAAGGAATGTG GAAAAAGGGGACGAAAACCAGGAAGAAAGACGTCTACTGAAAAATTGGAC ATGAAAGCCAAACTAGAACGCAGCAGACAAAGTGCCAGGGAATGCCGGGC GCGCAAGAAGCTGCGGTATCAGTACCTGGAGGAACTGGTGGCGGATCGGG AGAAGGCTGTAGTTGCTTTGCGTACGGAACTGGAGCGCTTAATTCAATGG AATAACCAGTTGAGCGAAAGCAACACTCCAACCAACAATGACCAGTTACT TCAGGAACTCGGAATCCTCAAACAAGAATAACCTACATTCTTATTTTTAG CTTAAGAATATTACTTTTATAATAAATGTACGACGGTTACTATTTATATT ATTATGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 10263803..10263968 | 339..504 | 830 | 100 | Plus |
chr2L | 23010047 | chr2L | 10262988..10263120 | 2..134 | 665 | 100 | Plus |
chr2L | 23010047 | chr2L | 10263618..10263741 | 215..338 | 620 | 100 | Plus |
chr2L | 23010047 | chr2L | 10263407..10263489 | 134..216 | 415 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10264947..10265118 | 339..510 | 845 | 99.4 | Plus |
2L | 23513712 | 2L | 10264132..10264264 | 2..134 | 665 | 100 | Plus |
2L | 23513712 | 2L | 10264762..10264885 | 215..338 | 620 | 100 | Plus |
2L | 23513712 | 2L | 10264551..10264633 | 134..216 | 415 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10264947..10265118 | 339..510 | 845 | 99.4 | Plus |
2L | 23513712 | 2L | 10264132..10264264 | 2..134 | 665 | 100 | Plus |
2L | 23513712 | 2L | 10264762..10264885 | 215..338 | 620 | 100 | Plus |
2L | 23513712 | 2L | 10264551..10264633 | 134..216 | 415 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Burdock | 6411 | Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). | 5561..5615 | 501..446 | 106 | 67.9 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 10263803..10263970 | 339..506 | 99 | Plus | |
chr2L | 10263620..10263741 | 217..338 | 100 | -> | Plus |
chr2L | 10262987..10263120 | 1..134 | 99 | -> | Plus |
chr2L | 10263408..10263489 | 135..216 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 1..354 | 78..431 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 1..354 | 78..431 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 1..354 | 78..431 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 1..354 | 78..431 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 1..354 | 78..431 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 2..506 | 2..506 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 2..506 | 2..506 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 7..512 | 1..506 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 2..506 | 2..506 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 7..512 | 1..506 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264131..10264264 | 1..134 | 99 | -> | Plus |
2L | 10264552..10264633 | 135..216 | 100 | -> | Plus |
2L | 10264764..10264885 | 217..338 | 100 | -> | Plus |
2L | 10264947..10265114 | 339..506 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264131..10264264 | 1..134 | 99 | -> | Plus |
2L | 10264552..10264633 | 135..216 | 100 | -> | Plus |
2L | 10264764..10264885 | 217..338 | 100 | -> | Plus |
2L | 10264947..10265114 | 339..506 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264131..10264264 | 1..134 | 99 | -> | Plus |
2L | 10264552..10264633 | 135..216 | 100 | -> | Plus |
2L | 10264764..10264885 | 217..338 | 100 | -> | Plus |
2L | 10264947..10265114 | 339..506 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 10264764..10264885 | 217..338 | 100 | -> | Plus |
arm_2L | 10264131..10264264 | 1..134 | 99 | -> | Plus |
arm_2L | 10264552..10264633 | 135..216 | 100 | -> | Plus |
arm_2L | 10264947..10265114 | 339..506 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264131..10264264 | 1..134 | 99 | -> | Plus |
2L | 10264552..10264633 | 135..216 | 100 | -> | Plus |
2L | 10264764..10264885 | 217..338 | 100 | -> | Plus |
2L | 10264947..10265114 | 339..506 | 99 | Plus |
Translation from 77 to 430
> RH73910.pep MADMEIQSNKMSITEETQVTRKECGKRGRKPGRKTSTEKLDMKAKLERSR QSARECRARKKLRYQYLEELVADREKAVVALRTELERLIQWNNQLSESNT PTNNDQLLQELGILKQE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15758-PA | 93 | GF15758-PA | 1..89 | 1..89 | 401 | 87.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10098-PA | 117 | GG10098-PA | 1..117 | 1..117 | 585 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13018-PA | 118 | GH13018-PA | 1..115 | 4..117 | 442 | 74.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
REPTOR-BP-PB | 117 | CG18619-PB | 1..117 | 1..117 | 586 | 100 | Plus |
REPTOR-BP-PA | 118 | CG18619-PA | 1..118 | 1..117 | 574 | 99.2 | Plus |
REPTOR-BP-PC | 93 | CG18619-PC | 1..89 | 1..89 | 435 | 97.8 | Plus |
REPTOR-BP-PD | 94 | CG18619-PD | 1..90 | 1..89 | 423 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18265-PA | 118 | GI18265-PA | 1..115 | 4..117 | 424 | 72.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19008-PA | 115 | GL19008-PA | 1..115 | 4..117 | 438 | 75.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15016-PA | 108 | GA15016-PA | 1..108 | 11..117 | 416 | 75.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18070-PA | 94 | GM18070-PA | 1..90 | 1..89 | 418 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23670-PA | 94 | GD23670-PA | 1..90 | 1..89 | 419 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17525-PA | 118 | GJ17525-PA | 1..115 | 4..117 | 433 | 73 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23539-PA | 111 | GK23539-PA | 1..108 | 11..117 | 388 | 71.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18912-PA | 117 | GE18912-PA | 1..117 | 1..117 | 584 | 97.4 | Plus |
Translation from 77 to 430
> RH73910.hyp MADMEIQSNKMSITEETQVTRKECGKRGRKPGRKTSTEKLDMKAKLERSR QSARECRARKKLRYQYLEELVADREKAVVALRTELERLIQWNNQLSESNT PTNNDQLLQELGILKQE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18619-PB | 117 | CG18619-PB | 1..117 | 1..117 | 586 | 100 | Plus |
CG18619-PA | 118 | CG18619-PA | 1..118 | 1..117 | 574 | 99.2 | Plus |
CG18619-PC | 93 | CG18619-PC | 1..89 | 1..89 | 435 | 97.8 | Plus |
CG18619-PD | 94 | CG18619-PD | 1..90 | 1..89 | 423 | 96.7 | Plus |