Clone RH74005 Report

Search the DGRC for RH74005

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:740
Well:5
Vector:pFlc-1
Associated Gene/TranscriptPebIII-RA
Protein status:RH74005.pep: gold
Preliminary Size:568
Sequenced Size:601

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11390 2002-01-01 Sim4 clustering to Release 2
CG11390 2002-04-26 Blastp of sequenced clone
CG11390 2003-01-01 Sim4 clustering to Release 3
PebIII 2008-04-29 Release 5.5 accounting
PebIII 2008-08-15 Release 5.9 accounting
PebIII 2008-12-18 5.12 accounting

Clone Sequence Records

RH74005.complete Sequence

601 bp (601 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113640

> RH74005.complete
TCCAGTTAGTTCCAGCAGCTGAATTGCTTCACATCTATTCGCTCCGAGTC
GCCCCACAAGTCGAGCCCCATTAAAACTCCAAGATGAAGATGATACTTGC
GCTTGTCGTCCTTGGACTGGTGCTGGTCGCCGCCGAGGATAAGTACACCA
CCAAGTACGACAACATCGACGTCGACGAGATCCTGAAGTCGGACCGCCTC
TTCGGAAACTACTTCAAGTGCCTGGTGGACAACGGAAAGTGCACCCCGGA
GGGCCGGGAGCTCAAGAAGTCCCTGCCGGACGCCCTGAAGACGGAGTGCA
GCAAGTGCAGCGAGAAGCAGCGCCAGAACACCGACAAGGTCATTCGCTAC
ATCATCGAAAACAAGCCCGAGGAGTGGAAGCAGCTGCAGGCCAAGTACGA
TCCCGATGAGATCTACATCAAGCGCTACCGCGCCACCGCCGAGGCCTCGG
GAATCAAGGTGTAAGGCGGATCCCGGTTCCGGAAACTCTTGGTTATATGC
ACTGTTAATTAGGTCTACGCTTATATCTGATCATCAAAATTATTTCTACG
ATCGTGCTCGGAATAAAGAGATTTGTTTTTTTACCAAAAAAAAAAAAAAA
A

RH74005.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
PebIII-RA 1061 PebIII-RA 164..747 3..586 2920 100 Plus
PebIII.b 1294 PebIII.b 478..1061 3..586 2920 100 Plus
PebIII.a 919 PebIII.a 322..905 3..586 2920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19913077..19913589 73..585 2535 99.6 Plus
chr2R 21145070 chr2R 19912620..19912689 3..72 350 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24027004..24027517 73..586 2570 100 Plus
2R 25286936 2R 24026547..24026616 3..72 350 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24028203..24028716 73..586 2570 100 Plus
2R 25260384 2R 24027746..24027815 3..72 350 100 Plus
Blast to na_te.dros performed 2019-03-16 20:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
G-element 4346 G-element DMREPG 4346bp Derived from X06950 (g8427) (Rel. 16, Last updated, Version 1). 1589..1626 132..169 118 78.9 Plus

RH74005.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:09:17 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19912617..19912689 1..72 98 -> Plus
chr2R 19913077..19913589 73..585 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:54:08 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 1..381 84..464 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:02 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 1..381 84..464 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:54 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 1..381 84..464 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:32 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 1..381 84..464 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:17 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 1..381 84..464 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:39 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 12..597 1..585 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:02 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 12..597 1..585 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:54 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 2..584 3..585 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:32 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 12..597 1..585 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:17 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 2..584 3..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:17 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24026544..24026616 1..72 98 -> Plus
2R 24027004..24027516 73..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:17 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24026544..24026616 1..72 98 -> Plus
2R 24027004..24027516 73..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:17 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24026544..24026616 1..72 98 -> Plus
2R 24027004..24027516 73..585 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:54 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19914067..19914139 1..72 98 -> Plus
arm_2R 19914527..19915039 73..585 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:07 Download gff for RH74005.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24028221..24028733 73..585 100   Plus
2R 24027761..24027833 1..72 98 -> Plus

RH74005.pep Sequence

Translation from 83 to 463

> RH74005.pep
MKMILALVVLGLVLVAAEDKYTTKYDNIDVDEILKSDRLFGNYFKCLVDN
GKCTPEGRELKKSLPDALKTECSKCSEKQRQNTDKVIRYIIENKPEEWKQ
LQAKYDPDEIYIKRYRATAEASGIKV*

RH74005.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12892-PA 126 GF12892-PA 1..126 1..126 575 84.1 Plus
Dana\GF11516-PA 127 GF11516-PA 5..122 1..118 330 49.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22923-PA 126 GG22923-PA 1..126 1..126 627 94.4 Plus
Dere\GG19868-PA 121 GG19868-PA 1..118 1..115 340 53.4 Plus
Dere\GG15834-PA 155 GG15834-PA 46..145 17..116 280 48 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21706-PA 127 GH21706-PA 1..127 1..126 499 71.7 Plus
Dgri\GH22042-PA 122 GH22042-PA 7..118 4..115 331 53.6 Plus
Dgri\GH12519-PA 132 GH12519-PA 5..116 14..122 281 46.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
EbpIII-PC 126 CG11390-PC 1..126 1..126 654 100 Plus
EbpIII-PB 126 CG11390-PB 1..126 1..126 654 100 Plus
EbpIII-PA 126 CG11390-PA 1..126 1..126 654 100 Plus
Phk-3-PC 121 CG9358-PC 1..114 1..111 334 57 Plus
Phk-3-PB 121 CG9358-PB 1..114 1..111 334 57 Plus
Phk-3-PA 121 CG9358-PA 1..114 1..111 334 57 Plus
a10-PA 155 CG6642-PA 47..145 18..116 290 48.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18859-PA 126 GI18859-PA 1..124 1..124 524 77.4 Plus
Dmoj\GI19129-PA 126 GI19129-PA 1..119 1..115 327 52.1 Plus
Dmoj\GI14872-PA 169 GI14872-PA 42..152 13..123 302 46.8 Plus
Dmoj\GI20684-PA 111 GI20684-PA 9..109 2..106 135 25.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11652-PA 126 GL11652-PA 1..126 1..126 512 81 Plus
Dper\GL10889-PA 125 GL10889-PA 1..122 1..120 329 51.6 Plus
Dper\GL15312-PA 149 GL15312-PA 44..138 21..115 268 48.4 Plus
Dper\GL15311-PA 68 GL15311-PA 2..66 60..125 150 43.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10970-PA 126 GA10970-PA 1..126 1..126 512 81 Plus
Dpse\GA21727-PA 125 GA21727-PA 1..122 1..120 329 51.6 Plus
Dpse\GA19747-PA 149 GA19747-PA 44..138 21..115 268 48.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18290-PA 126 GM18290-PA 1..126 1..126 638 97.6 Plus
Dsec\GM11771-PA 121 GM11771-PA 1..118 1..115 353 55.9 Plus
Dsec\GM24353-PA 155 GM24353-PA 47..145 18..116 275 47.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11826-PA 126 GD11826-PA 1..126 1..126 648 98.4 Plus
Dsim\GD24902-PA 121 GD24902-PA 1..120 1..117 358 55.8 Plus
Dsim\GD12430-PA 155 GD12430-PA 47..145 18..116 279 48.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20447-PA 126 GJ20447-PA 1..126 1..126 542 81 Plus
Dvir\GJ22262-PA 125 GJ22262-PA 5..119 1..115 342 53.9 Plus
Dvir\GJ19536-PA 163 GJ19536-PA 28..146 6..123 294 44.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21931-PA 127 GK21931-PA 1..126 1..126 508 70.6 Plus
Dwil\GK19506-PA 127 GK19506-PA 22..124 18..120 317 54.4 Plus
Dwil\GK24936-PA 171 GK24936-PA 51..148 21..118 264 45.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\PebIII-PA 126 GE14360-PA 1..126 1..126 627 93.7 Plus
Dyak\Phk-3-PA 121 GE11392-PA 1..120 1..117 332 50 Plus
Dyak\GE22174-PA 155 GE22174-PA 47..145 18..116 278 47.5 Plus

RH74005.hyp Sequence

Translation from 83 to 463

> RH74005.hyp
MKMILALVVLGLVLVAAEDKYTTKYDNIDVDEILKSDRLFGNYFKCLVDN
GKCTPEGRELKKSLPDALKTECSKCSEKQRQNTDKVIRYIIENKPEEWKQ
LQAKYDPDEIYIKRYRATAEASGIKV*

RH74005.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
PebIII-PC 126 CG11390-PC 1..126 1..126 654 100 Plus
PebIII-PB 126 CG11390-PB 1..126 1..126 654 100 Plus
PebIII-PA 126 CG11390-PA 1..126 1..126 654 100 Plus
Phk-3-PC 121 CG9358-PC 1..114 1..111 334 57 Plus
Phk-3-PB 121 CG9358-PB 1..114 1..111 334 57 Plus