Clone RH74092 Report

Search the DGRC for RH74092

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:740
Well:92
Vector:pFlc-1
Associated Gene/TranscriptCG9686-RA
Protein status:RH74092.pep: gold
Preliminary Size:633
Sequenced Size:677

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9686 2002-01-01 Sim4 clustering to Release 2
CG9686 2002-04-26 Blastp of sequenced clone
CG9686 2003-01-01 Sim4 clustering to Release 3
CG9686 2008-04-29 Release 5.5 accounting
CG9686 2008-08-15 Release 5.9 accounting
CG9686 2008-12-18 5.12 accounting

Clone Sequence Records

RH74092.complete Sequence

677 bp (677 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113642

> RH74092.complete
ATTGAGGTCAGTCCAGTATCAGTGGAGTCAACGTTCAGTCTGGTTTTTGT
GGATAAAGCCAAAGGAACCGAATATATCAAGATGAATAGCTTGCAAGGAT
CGCTGGTCCTCCTGCTGCTCGCCGGAGTTTTTCTTCAAAGTCAGGCGGGT
CTCTTCGATTGCGAGGACAAGATACCCGGACTTGGAGATGTGAGCGATAA
GATATCGGAGATTACGGGCAGCAGTAGCAGTTCGGAGCACGAGGTGCGCG
ACTTCTTCAAGAACGTGGGATGCCACATCAAGGAGGGAGCCAAGAAGCTG
GGCGAGAAGGCCAAGGACTTGGGCACGGAACTCAAAGAGGGCGCCCAGAA
GCTGGGCGAGAAGGCCAAGGTCCTGGGTAGCGATCTCAAGGATCGCTTCG
ATGACTTCCGCGACAAGCTGGCCAAGGATTCCGCCGAGGAGATGAGCAAG
GATCGCGGCTTTCTGGCCAACGTGGAGATTATCAATCCGGACATCCTCAA
GGGCGAGCAGCAGTGTGGGCATGGACACATTCTGGATGCATTGGGCAACT
GCAGCAAATTGAGGAAATAGTCCCCAAAGAGTCCTACCCCCTCCCGTTAA
CACTTAAGTTTTTTTATGAGTTTTTTTTTTTTATGTGTAAATAAAAATGG
ACAGTAAAAATACAAAAAAAAAAAAAA

RH74092.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG9686-RA 667 CG9686-RA 5..666 5..666 3295 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:48:01
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9771579..9772237 5..663 3280 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9879873..9880534 5..666 3295 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9887971..9888632 5..666 3295 99.8 Plus
Blast to na_te.dros performed 2019-03-15 16:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
Tc3 1743 Tc3 TC3 1743bp 1533..1593 600..662 120 69.8 Plus

RH74092.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:48:40 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9771575..9772237 1..663 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:54:10 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
CG9686-RA 1..489 82..570 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:05 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
CG9686-RA 1..489 82..570 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:10:41 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
CG9686-RA 1..489 82..570 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:34 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
CG9686-RA 1..489 82..570 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:50:34 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
CG9686-RA 1..489 82..570 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:42 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
CG9686-RA 5..663 5..663 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:04 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
CG9686-RA 5..663 5..663 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:41 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
CG9686-RA 4..662 5..663 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:34 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
CG9686-RA 5..663 5..663 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:50:34 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
CG9686-RA 4..662 5..663 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:40 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
X 9879869..9880531 1..663 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:40 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
X 9879869..9880531 1..663 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:40 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
X 9879869..9880531 1..663 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:41 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9773902..9774564 1..663 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:10 Download gff for RH74092.complete
Subject Subject Range Query Range Percent Splice Strand
X 9887967..9888629 1..663 99   Plus

RH74092.hyp Sequence

Translation from 0 to 569

> RH74092.hyp
PQVSPVSVESTFSLVFVDKAKGTEYIKMNSLQGSLVLLLLAGVFLQSQAG
LFDCEDKIPGLGDVSDKISEITGSSSSSEHEVRDFFKNVGCHIKEGAKKL
GEKAKDLGTELKEGAQKLGEKAKVLGSDLKDRFDDFRDKLAKDSAEEMSK
DRGFLANVEIINPDILKGEQQCGHGHILDALGNCSKLRK*

RH74092.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG9686-PA 162 CG9686-PA 1..162 28..189 827 100 Plus

RH74092.pep Sequence

Translation from 81 to 569

> RH74092.pep
MNSLQGSLVLLLLAGVFLQSQAGLFDCEDKIPGLGDVSDKISEITGSSSS
SEHEVRDFFKNVGCHIKEGAKKLGEKAKDLGTELKEGAQKLGEKAKVLGS
DLKDRFDDFRDKLAKDSAEEMSKDRGFLANVEIINPDILKGEQQCGHGHI
LDALGNCSKLRK*

RH74092.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19138-PA 162 GF19138-PA 1..162 1..162 766 92.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18329-PA 162 GG18329-PA 1..162 1..162 799 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11807-PA 163 GH11807-PA 20..163 20..162 574 80.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG9686-PA 162 CG9686-PA 1..162 1..162 827 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15989-PA 163 GI15989-PA 19..163 19..162 570 79.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16379-PA 165 GL16379-PA 1..165 1..162 613 82.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21964-PA 165 GA21964-PA 1..165 1..162 619 83 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11393-PA 162 GM11393-PA 1..162 1..162 812 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12220-PA 162 GD12220-PA 1..162 1..162 816 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18718-PA 163 GJ18718-PA 1..163 1..162 579 76.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18849-PA 168 GK18849-PA 22..168 15..162 615 83.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17815-PA 162 GE17815-PA 1..162 1..162 809 98.1 Plus