BDGP Sequence Production Resources |
Search the DGRC for RH74092
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 740 |
Well: | 92 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG9686-RA |
Protein status: | RH74092.pep: gold |
Preliminary Size: | 633 |
Sequenced Size: | 677 |
Gene | Date | Evidence |
---|---|---|
CG9686 | 2002-01-01 | Sim4 clustering to Release 2 |
CG9686 | 2002-04-26 | Blastp of sequenced clone |
CG9686 | 2003-01-01 | Sim4 clustering to Release 3 |
CG9686 | 2008-04-29 | Release 5.5 accounting |
CG9686 | 2008-08-15 | Release 5.9 accounting |
CG9686 | 2008-12-18 | 5.12 accounting |
677 bp (677 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113642
> RH74092.complete ATTGAGGTCAGTCCAGTATCAGTGGAGTCAACGTTCAGTCTGGTTTTTGT GGATAAAGCCAAAGGAACCGAATATATCAAGATGAATAGCTTGCAAGGAT CGCTGGTCCTCCTGCTGCTCGCCGGAGTTTTTCTTCAAAGTCAGGCGGGT CTCTTCGATTGCGAGGACAAGATACCCGGACTTGGAGATGTGAGCGATAA GATATCGGAGATTACGGGCAGCAGTAGCAGTTCGGAGCACGAGGTGCGCG ACTTCTTCAAGAACGTGGGATGCCACATCAAGGAGGGAGCCAAGAAGCTG GGCGAGAAGGCCAAGGACTTGGGCACGGAACTCAAAGAGGGCGCCCAGAA GCTGGGCGAGAAGGCCAAGGTCCTGGGTAGCGATCTCAAGGATCGCTTCG ATGACTTCCGCGACAAGCTGGCCAAGGATTCCGCCGAGGAGATGAGCAAG GATCGCGGCTTTCTGGCCAACGTGGAGATTATCAATCCGGACATCCTCAA GGGCGAGCAGCAGTGTGGGCATGGACACATTCTGGATGCATTGGGCAACT GCAGCAAATTGAGGAAATAGTCCCCAAAGAGTCCTACCCCCTCCCGTTAA CACTTAAGTTTTTTTATGAGTTTTTTTTTTTTATGTGTAAATAAAAATGG ACAGTAAAAATACAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9686-RA | 667 | CG9686-RA | 5..666 | 5..666 | 3295 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 9771579..9772237 | 5..663 | 3280 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 9879873..9880534 | 5..666 | 3295 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 9887971..9888632 | 5..666 | 3295 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tc3 | 1743 | Tc3 TC3 1743bp | 1533..1593 | 600..662 | 120 | 69.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 9771575..9772237 | 1..663 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9686-RA | 1..489 | 82..570 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9686-RA | 1..489 | 82..570 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9686-RA | 1..489 | 82..570 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9686-RA | 1..489 | 82..570 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9686-RA | 1..489 | 82..570 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9686-RA | 5..663 | 5..663 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9686-RA | 5..663 | 5..663 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9686-RA | 4..662 | 5..663 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9686-RA | 5..663 | 5..663 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9686-RA | 4..662 | 5..663 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9879869..9880531 | 1..663 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9879869..9880531 | 1..663 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9879869..9880531 | 1..663 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 9773902..9774564 | 1..663 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9887967..9888629 | 1..663 | 99 | Plus |
Translation from 0 to 569
> RH74092.hyp PQVSPVSVESTFSLVFVDKAKGTEYIKMNSLQGSLVLLLLAGVFLQSQAG LFDCEDKIPGLGDVSDKISEITGSSSSSEHEVRDFFKNVGCHIKEGAKKL GEKAKDLGTELKEGAQKLGEKAKVLGSDLKDRFDDFRDKLAKDSAEEMSK DRGFLANVEIINPDILKGEQQCGHGHILDALGNCSKLRK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9686-PA | 162 | CG9686-PA | 1..162 | 28..189 | 827 | 100 | Plus |
Translation from 81 to 569
> RH74092.pep MNSLQGSLVLLLLAGVFLQSQAGLFDCEDKIPGLGDVSDKISEITGSSSS SEHEVRDFFKNVGCHIKEGAKKLGEKAKDLGTELKEGAQKLGEKAKVLGS DLKDRFDDFRDKLAKDSAEEMSKDRGFLANVEIINPDILKGEQQCGHGHI LDALGNCSKLRK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19138-PA | 162 | GF19138-PA | 1..162 | 1..162 | 766 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18329-PA | 162 | GG18329-PA | 1..162 | 1..162 | 799 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11807-PA | 163 | GH11807-PA | 20..163 | 20..162 | 574 | 80.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9686-PA | 162 | CG9686-PA | 1..162 | 1..162 | 827 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15989-PA | 163 | GI15989-PA | 19..163 | 19..162 | 570 | 79.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16379-PA | 165 | GL16379-PA | 1..165 | 1..162 | 613 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21964-PA | 165 | GA21964-PA | 1..165 | 1..162 | 619 | 83 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11393-PA | 162 | GM11393-PA | 1..162 | 1..162 | 812 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12220-PA | 162 | GD12220-PA | 1..162 | 1..162 | 816 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18718-PA | 163 | GJ18718-PA | 1..163 | 1..162 | 579 | 76.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18849-PA | 168 | GK18849-PA | 22..168 | 15..162 | 615 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17815-PA | 162 | GE17815-PA | 1..162 | 1..162 | 809 | 98.1 | Plus |