Clone RH74176 Report

Search the DGRC for RH74176

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:741
Well:76
Vector:pFlc-1
Associated Gene/TranscriptMlp60A-RE
Protein status:RH74176.pep: gold
Preliminary Size:1542
Sequenced Size:452

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3220 2002-01-01 Sim4 clustering to Release 2
CG33149 2002-04-26 Blastp of sequenced clone
CG33149 2003-01-01 Sim4 clustering to Release 3
Mlp60A 2008-04-29 Release 5.5 accounting
Mlp60A 2008-08-15 Release 5.9 accounting
Mlp60A 2008-12-18 5.12 accounting

Clone Sequence Records

RH74176.complete Sequence

452 bp (452 high quality bases) assembled on 2005-08-25

GenBank Submission: AY113643

> RH74176.complete
GAGTCTAGTCCGCGGCATTTCCGACGAATAGGAACTACTTCACAGAGTAC
CTCCGAGACACACACACGCACTCAGATCAAAATGCCTTTCGTTCCCGTTG
AAACCCCCAAGTGCCCCGCGTGCGGCAAGTCGGTCTACGCTGCCGAGGAG
CGCGTTGCCGGAGGCTACAAATTCCACAAGACCTGCTTCAAGTGCAGCAT
GTGCAACAAGGCCCTGGACTCGACCAACTGCACGGAGCACGAGAAGGAGC
TTTTCTGCAAAAACTGCCATGGTCGCAAATACGGTCCCAAGGGATACGGT
TTCGGTGGTGGTGCCGGCTGCCTGTCCACGGACACTGGCGCCCACTTAAA
CAGAGAGTAAGGACTAAATAAGAAATATGTTTTGTATGAAAATTGTGTAA
AATTCCTTGAATTAAATGTGTAGTTTTGCTTTCTATTAAAAAAAAAAAAA
AA

RH74176.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Mlp60A-RE 830 Mlp60A-RE 370..806 2..438 2185 100 Plus
Mlp60A.a 1070 Mlp60A.a 370..806 2..438 2185 100 Plus
Mlp60A.b 1324 Mlp60A.b 370..806 2..438 2185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19961443..19961683 197..437 1205 100 Plus
chr2R 21145070 chr2R 19961191..19961332 56..197 710 100 Plus
chr3R 27901430 chr3R 2941544..2941774 334..104 420 78.8 Minus
chr2R 21145070 chr2R 19961006..19961061 2..57 280 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24075449..24075690 197..438 1210 100 Plus
2R 25286936 2R 24075197..24075338 56..197 710 100 Plus
3R 32079331 3R 7115504..7115734 334..104 420 78.8 Minus
2R 25286936 2R 24075014..24075069 2..57 280 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24076648..24076889 197..438 1210 100 Plus
2R 25260384 2R 24076396..24076537 56..197 710 100 Plus
3R 31820162 3R 6856335..6856565 334..104 420 78.7 Minus
2R 25260384 2R 24076213..24076268 2..57 280 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:49:56 has no hits.

RH74176.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:51:02 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19961193..19961331 58..196 100 -> Plus
chr2R 19961443..19961683 197..437 100   Plus
chr2R 19961005..19961061 1..57 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:54:12 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
Mlp60A-RE 1..279 82..360 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:53:25 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
Mlp60A-RE 1..279 82..360 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:48:18 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
Mlp60A-RE 1..279 82..360 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:34:06 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
Mlp60A-RE 1..279 82..360 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:40:34 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
Mlp60A-RF 1..279 82..360 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:28:25 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
Mlp60A-RE 2..437 2..437 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:53:24 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
Mlp60A-RE 2..437 2..437 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:48:18 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
Mlp60A-RE 2..438 1..437 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:34:07 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
Mlp60A-RE 2..437 2..437 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:40:34 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
Mlp60A-RE 2..438 1..437 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:02 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24075013..24075069 1..57 98 -> Plus
2R 24075199..24075337 58..196 100 -> Plus
2R 24075449..24075689 197..437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:02 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24075013..24075069 1..57 98 -> Plus
2R 24075199..24075337 58..196 100 -> Plus
2R 24075449..24075689 197..437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:02 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24075013..24075069 1..57 98 -> Plus
2R 24075199..24075337 58..196 100 -> Plus
2R 24075449..24075689 197..437 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:48:18 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19962536..19962592 1..57 98 -> Plus
arm_2R 19962722..19962860 58..196 100 -> Plus
arm_2R 19962972..19963212 197..437 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:12:41 Download gff for RH74176.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24076666..24076906 197..437 100   Plus
2R 24076230..24076286 1..57 98 -> Plus
2R 24076416..24076554 58..196 100 -> Plus

RH74176.hyp Sequence

Translation from 0 to 359

> RH74176.hyp
QSSPRHFRRIGTTSQSTSETHTRTQIKMPFVPVETPKCPACGKSVYAAEE
RVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGYG
FGGGAGCLSTDTGAHLNRE*

RH74176.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Mlp60A-PE 92 CG33149-PA 1..92 28..119 530 100 Plus
Mlp60A-PF 92 CG42309-PF 1..92 28..119 530 100 Plus
Mlp60A-PC 486 CG42309-PC 1..92 28..119 530 100 Plus
Mlp60A-PB 486 CG42309-PB 1..92 28..119 530 100 Plus
Mlp84B-PC 495 CG1019-PC 4..93 30..119 410 76.7 Plus
Mlp60A-PC 486 CG42309-PC 83..174 20..103 208 42.4 Plus
Mlp60A-PB 486 CG42309-PB 83..174 20..103 208 42.4 Plus
Mlp60A-PC 486 CG42309-PC 213..287 38..111 206 48 Plus
Mlp60A-PB 486 CG42309-PB 213..287 38..111 206 48 Plus
Mlp60A-PC 486 CG42309-PC 412..484 38..109 180 45.2 Plus
Mlp60A-PB 486 CG42309-PB 412..484 38..109 180 45.2 Plus
Mlp60A-PC 486 CG42309-PC 285..390 15..111 175 33 Plus
Mlp60A-PB 486 CG42309-PB 285..390 15..111 175 33 Plus

RH74176.pep Sequence

Translation from 81 to 359

> RH74176.pep
MPFVPVETPKCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNC
TEHEKELFCKNCHGRKYGPKGYGFGGGAGCLSTDTGAHLNRE*

RH74176.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11369-PA 92 GF11369-PA 1..92 1..92 475 98.9 Plus
Dana\GF17323-PA 495 GF17323-PA 1..93 1..92 375 76.3 Plus
Dana\GF17323-PA 495 GF17323-PA 222..296 11..84 198 48 Plus
Dana\GF17323-PA 495 GF17323-PA 411..494 5..83 188 46.4 Plus
Dana\GF11368-PA 366 GF11368-PA 93..167 11..84 178 48 Plus
Dana\GF11368-PA 366 GF11368-PA 286..364 5..82 176 46.8 Plus
Dana\GF17323-PA 495 GF17323-PA 120..198 11..88 165 53.2 Plus
Dana\GF17323-PA 495 GF17323-PA 325..398 11..83 156 40.5 Plus
Dana\GF11368-PA 366 GF11368-PA 196..269 11..83 154 40.5 Plus
Dana\GF18032-PA 814 GF18032-PA 3..69 10..75 138 38.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22934-PA 92 GG22934-PA 1..92 1..92 473 97.8 Plus
Dere\GG10080-PA 495 GG10080-PA 1..93 1..92 375 76.3 Plus
Dere\GG10080-PA 495 GG10080-PA 222..296 11..84 197 48 Plus
Dere\GG10080-PA 495 GG10080-PA 411..494 5..83 189 46.4 Plus
Dere\GG22935-PA 167 GG22935-PA 90..164 11..84 184 48 Plus
Dere\GG10080-PA 495 GG10080-PA 120..198 11..88 166 53.2 Plus
Dere\GG22937-PA 178 GG22937-PA 104..176 11..82 161 46.6 Plus
Dere\GG10080-PA 495 GG10080-PA 325..398 11..83 154 39.2 Plus
Dere\GG22937-PA 178 GG22937-PA 8..82 11..84 150 38.7 Plus
Dere\GG12462-PA 806 GG12462-PA 3..69 10..75 139 38.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21720-PA 92 GH21720-PA 1..92 1..92 391 95.7 Plus
Dgri\GH18591-PA 492 GH18591-PA 1..90 1..90 379 74.4 Plus
Dgri\GH18591-PA 492 GH18591-PA 219..293 11..84 189 45.3 Plus
Dgri\GH18591-PA 492 GH18591-PA 418..491 11..83 183 47.3 Plus
Dgri\GH18591-PA 492 GH18591-PA 322..395 11..83 161 39.2 Plus
Dgri\GH18591-PA 492 GH18591-PA 117..177 11..70 158 50.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Mlp60A-PE 92 CG33149-PA 1..92 1..92 530 100 Plus
Mlp60A-PF 92 CG42309-PF 1..92 1..92 530 100 Plus
Mlp60A-PC 486 CG42309-PC 1..92 1..92 530 100 Plus
Mlp60A-PB 486 CG42309-PB 1..92 1..92 530 100 Plus
Mlp84B-PC 495 CG1019-PC 4..93 3..92 410 76.7 Plus
Mlp84B-PB 495 CG1019-PB 4..93 3..92 410 76.7 Plus
Mlp84B-PA 495 CG1019-PA 4..93 3..92 410 76.7 Plus
Mlp84B-PC 495 CG1019-PC 120..198 11..88 244 53.2 Plus
Mlp84B-PB 495 CG1019-PB 120..198 11..88 244 53.2 Plus
Mlp84B-PA 495 CG1019-PA 120..198 11..88 244 53.2 Plus
Mlp84B-PC 495 CG1019-PC 222..296 11..84 223 48 Plus
Mlp84B-PB 495 CG1019-PB 222..296 11..84 223 48 Plus
Mlp84B-PA 495 CG1019-PA 222..296 11..84 223 48 Plus
Mlp84B-PC 495 CG1019-PC 411..494 5..83 210 46.4 Plus
Mlp84B-PB 495 CG1019-PB 411..494 5..83 210 46.4 Plus
Mlp84B-PA 495 CG1019-PA 411..494 5..83 210 46.4 Plus
Mlp60A-PC 486 CG42309-PC 213..287 11..84 206 48 Plus
Mlp60A-PB 486 CG42309-PB 213..287 11..84 206 48 Plus
Mlp60A-PC 486 CG42309-PC 96..174 2..76 203 45.6 Plus
Mlp60A-PB 486 CG42309-PB 96..174 2..76 203 45.6 Plus
Mlp60A-PC 486 CG42309-PC 412..484 11..82 180 45.2 Plus
Mlp60A-PB 486 CG42309-PB 412..484 11..82 180 45.2 Plus
Mlp84B-PC 495 CG1019-PC 325..398 11..83 179 39.2 Plus
Mlp84B-PB 495 CG1019-PB 325..398 11..83 179 39.2 Plus
Mlp84B-PA 495 CG1019-PA 325..398 11..83 179 39.2 Plus
Mlp60A-PC 486 CG42309-PC 299..390 2..84 173 35.9 Plus
Mlp60A-PB 486 CG42309-PB 299..390 2..84 173 35.9 Plus
Rassf-PA 806 CG4656-PA 3..69 10..75 141 38.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20682-PA 92 GI20682-PA 1..92 1..92 474 98.9 Plus
Dmoj\GI24519-PA 490 GI24519-PA 1..90 1..90 380 76.7 Plus
Dmoj\GI24519-PA 490 GI24519-PA 217..291 11..84 189 45.3 Plus
Dmoj\GI24519-PA 490 GI24519-PA 416..489 11..83 183 47.3 Plus
Dmoj\GI24519-PA 490 GI24519-PA 320..393 11..83 167 41.9 Plus
Dmoj\GI24519-PA 490 GI24519-PA 115..201 11..91 158 48.3 Plus
Dmoj\GI24577-PA 828 GI24577-PA 3..69 10..75 139 38.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11662-PA 92 GL11662-PA 1..92 1..92 473 97.8 Plus
Dper\GL12199-PA 494 GL12199-PA 1..92 1..92 386 77.2 Plus
Dper\GL12199-PA 494 GL12199-PA 221..295 11..84 196 48 Plus
Dper\GL12199-PA 494 GL12199-PA 420..493 11..83 180 50 Plus
Dper\GL11663-PA 156 GL11663-PA 82..154 11..82 172 47.9 Plus
Dper\GL12199-PA 494 GL12199-PA 115..197 7..88 163 51.8 Plus
Dper\GL12199-PA 494 GL12199-PA 320..397 7..83 160 39.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24805-PA 92 GA24805-PA 1..92 1..92 473 97.8 Plus
Dpse\GA26225-PA 494 GA26225-PA 1..92 1..92 386 77.2 Plus
Dpse\GA26225-PA 494 GA26225-PA 221..295 11..84 196 48 Plus
Dpse\GA15703-PA 360 GA15703-PA 89..163 11..84 182 48 Plus
Dpse\GA26225-PA 494 GA26225-PA 420..493 11..83 180 50 Plus
Dpse\GA15703-PA 360 GA15703-PA 286..358 11..82 171 47.9 Plus
Dpse\GA26225-PA 494 GA26225-PA 115..197 7..88 163 51.8 Plus
Dpse\GA26225-PA 494 GA26225-PA 320..397 7..83 160 39.7 Plus
Dpse\GA15703-PA 360 GA15703-PA 190..277 11..91 154 37.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18301-PA 92 GM18301-PA 1..92 1..92 480 100 Plus
Dsec\GM10508-PA 495 GM10508-PA 1..93 1..92 375 76.3 Plus
Dsec\GM10508-PA 495 GM10508-PA 222..296 11..84 197 48 Plus
Dsec\GM10508-PA 495 GM10508-PA 411..494 5..83 188 46.4 Plus
Dsec\GM10508-PA 495 GM10508-PA 120..198 11..88 166 53.2 Plus
Dsec\GM10508-PA 495 GM10508-PA 325..398 11..83 155 39.2 Plus
Dsec\GM23592-PA 806 GM23592-PA 3..69 10..75 139 38.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11833-PA 289 GD11833-PA 1..71 1..71 382 100 Plus
Dsim\GD19505-PA 495 GD19505-PA 1..93 1..92 375 76.3 Plus
Dsim\GD19505-PA 495 GD19505-PA 222..296 11..84 195 48 Plus
Dsim\GD19505-PA 495 GD19505-PA 411..494 5..83 188 46.4 Plus
Dsim\GD19505-PA 495 GD19505-PA 120..198 11..88 166 53.2 Plus
Dsim\GD15459-PA 152 GD15459-PA 78..150 11..82 162 46.6 Plus
Dsim\GD19505-PA 495 GD19505-PA 325..398 11..83 155 39.2 Plus
Dsim\GD18406-PA 806 GD18406-PA 3..69 10..75 139 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20431-PA 92 GJ20431-PA 1..92 1..92 468 97.8 Plus
Dvir\GJ22693-PA 491 GJ22693-PA 1..90 1..90 385 78.9 Plus
Dvir\GJ22693-PA 491 GJ22693-PA 218..292 11..84 194 48 Plus
Dvir\GJ22693-PA 491 GJ22693-PA 417..490 11..83 183 47.3 Plus
Dvir\GJ22693-PA 491 GJ22693-PA 321..394 11..83 160 39.2 Plus
Dvir\GJ22693-PA 491 GJ22693-PA 116..202 11..91 157 47.1 Plus
Dvir\GJ22644-PA 839 GJ22644-PA 3..69 10..75 139 38.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21388-PA 98 GK21388-PA 1..92 1..92 474 97.8 Plus
Dwil\GK19204-PA 494 GK19204-PA 1..91 1..91 377 75.8 Plus
Dwil\GK19204-PA 494 GK19204-PA 221..295 11..84 193 46.7 Plus
Dwil\GK21389-PA 366 GK21389-PA 85..167 6..84 186 45.8 Plus
Dwil\GK19204-PA 494 GK19204-PA 420..493 11..83 185 48.6 Plus
Dwil\GK21389-PA 366 GK21389-PA 283..364 2..82 182 46.3 Plus
Dwil\GK19204-PA 494 GK19204-PA 119..197 11..88 165 53.2 Plus
Dwil\GK21389-PA 366 GK21389-PA 179..270 2..84 153 35.9 Plus
Dwil\GK19204-PA 494 GK19204-PA 324..397 11..83 152 39.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Mlp60A-PA 92 GE14371-PA 1..92 1..92 480 100 Plus
Dyak\GE25818-PA 495 GE25818-PA 1..93 1..92 375 76.3 Plus
Dyak\GE25818-PA 495 GE25818-PA 222..296 11..84 197 48 Plus
Dyak\GE25818-PA 495 GE25818-PA 411..494 5..83 188 46.4 Plus
Dyak\GE14374-PA 167 GE14374-PA 90..164 11..84 183 48 Plus
Dyak\GE25818-PA 495 GE25818-PA 120..198 11..88 166 53.2 Plus
Dyak\GE14375-PA 178 GE14375-PA 104..176 11..82 162 46.6 Plus
Dyak\GE25818-PA 495 GE25818-PA 325..398 11..83 154 39.2 Plus
Dyak\GE14375-PA 178 GE14375-PA 8..82 11..84 154 40 Plus
Dyak\GE23984-PA 806 GE23984-PA 3..69 10..75 139 38.8 Plus