Clone RH74240 Report

Search the DGRC for RH74240

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:742
Well:40
Vector:pFlc-1
Associated Gene/TranscriptCG31084-RA
Protein status:RH74240.pep: validated full length
Sequenced Size:497

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5441 2002-01-01 Sim4 clustering to Release 2
CG31084 2002-04-26 Blastp of sequenced clone
CG31084 2003-01-01 Sim4 clustering to Release 3
CG31084 2008-04-29 Release 5.5 accounting
CG31084 2008-08-15 Release 5.9 accounting
CG31084 2008-12-18 5.12 accounting

Clone Sequence Records

RH74240.complete Sequence

497 bp (497 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113644

> RH74240.complete
GGTTGGTATTGGGAGTTTTGTGGGCACTCTCCGCGGATGGTGCGCTTTGC
GGTGCACTTGTTACCCTCCTTCTTGAATGGGGCGGGGCAGCTCTTGGCCG
AAACAGTCATGGCGATGAGGGCCAAGATGAAGATGCCACGAACAGCTGTT
TGGTTTTTAGCCCTTAACCCGCTGCTTATGCCGGGCGGCTTTTTCCTCCC
AGTTGATGCGGTGGCAACCTCAGGCATTGACTTTGGTAAAATTGTGGCAC
GCCAAGCACATTTTGAAGCTCATCAGTAATACAGTTACACAGCGGGCCTC
CTCCGGGCGTTGAGGCGATGAGGGGGCGAGGCGGAGCACCGCCACCACCG
CCGCACTCTGCTGCCGTTATTACACGATGAGAAATAATGGTGAAACAATT
TAATAAAAACTCATAGATTTTAATAGTTAATAAGCGCTTAAATAAATGTT
AGACTTTCAAATCAGTAAAATGATTTCCAAAGAAAAAAAAAAAAAAA

RH74240.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG31084-RA 490 CG31084-RA 1..485 1..485 2425 100 Plus
CG34291.a 273 CG34291.a 102..236 135..1 675 100 Minus
CG34291.b 495 CG34291.b 102..236 135..1 675 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22250974..22251173 135..334 1000 100 Plus
chr3R 27901430 chr3R 22251264..22251413 333..482 750 100 Plus
chr3R 27901430 chr3R 22248367..22248501 1..135 675 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26427961..26428160 135..334 1000 100 Plus
3R 32079331 3R 26428251..26428403 333..485 765 100 Plus
3R 32079331 3R 26425354..26425488 1..135 675 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26168792..26168991 135..334 1000 100 Plus
3R 31820162 3R 26169082..26169234 333..485 765 100 Plus
3R 31820162 3R 26166185..26166319 1..135 675 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:01:32 has no hits.

RH74240.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:02:09 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22248367..22248501 1..135 100 -> Plus
chr3R 22250975..22251176 136..336 99 -> Plus
chr3R 22251268..22251413 337..482 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:54:15 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
CG31084-RA 1..243 37..279 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:37 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
CG31084-RA 1..243 37..279 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:15 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
CG31084-RA 1..482 1..482 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:10 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
CG34291-RA 69..203 1..135 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:56 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
CG34291-RA 69..203 1..135 100   Minus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:37 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
CG31084-RA 1..482 1..482 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:20 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
CG34291-RA 69..203 1..135 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:02:09 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26425354..26425488 1..135 100 -> Plus
3R 26427962..26428159 136..333 100 -> Plus
3R 26428252..26428400 334..482 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:02:09 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26425354..26425488 1..135 100 -> Plus
3R 26427962..26428159 136..333 100 -> Plus
3R 26428252..26428400 334..482 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:02:09 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26425354..26425488 1..135 100 -> Plus
3R 26427962..26428159 136..333 100 -> Plus
3R 26428252..26428400 334..482 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:56 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22251076..22251210 1..135 100 -> Plus
arm_3R 22253684..22253881 136..333 100 -> Plus
arm_3R 22253974..22254122 334..482 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:56 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22251076..22251210 1..135 100 -> Plus
arm_3R 22253684..22253881 136..333 100 -> Plus
arm_3R 22253974..22254122 334..482 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:06 Download gff for RH74240.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26166185..26166319 1..135 100 -> Plus
3R 26168793..26168990 136..333 100 -> Plus
3R 26169083..26169231 334..482 100   Plus

RH74240.hyp Sequence

Translation from 0 to 278

> RH74240.hyp
GWYWEFCGHSPRMVRFAVHLLPSFLNGAGQLLAETVMAMRAKMKMPRTAV
WFLALNPLLMPGGFFLPVDAVATSGIDFGKIVARQAHFEAHQ*
Sequence RH74240.hyp has no blast hits.

RH74240.pep Sequence

Translation from 36 to 278

> RH74240.pep
MVRFAVHLLPSFLNGAGQLLAETVMAMRAKMKMPRTAVWFLALNPLLMPG
GFFLPVDAVATSGIDFGKIVARQAHFEAHQ*

RH74240.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11474-PA 69 GG11474-PA 1..69 1..80 280 75 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23666-PA 41 GE23666-PA 1..37 1..37 150 83.8 Plus