Clone RH74410 Report

Search the DGRC for RH74410

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:744
Well:10
Vector:pFlc-1
Associated Gene/TranscriptCG7172-RA
Protein status:RH74410.pep: gold
Preliminary Size:754
Sequenced Size:853

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7172 2002-01-01 Sim4 clustering to Release 2
CG7172 2002-04-26 Blastp of sequenced clone
CG7172 2003-01-01 Sim4 clustering to Release 3
CG7172 2008-04-29 Release 5.5 accounting
CG7172 2008-08-15 Release 5.9 accounting
CG7172 2008-12-18 5.12 accounting

Clone Sequence Records

RH74410.complete Sequence

853 bp (853 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113645

> RH74410.complete
ATGGATTTTCTCTCATCTCTATTGGAAATTAATAAACTATTTTGCTTAGA
CAATACAATTCAAAATGAATGTAGGCAAGATAAGCGTTGTCACCAGACTT
CCTGCCCTCCGCTCGTGCGCCCAGTACTCGAGCGCTGCGAAAGCGGAACT
GCCGGCTTCCTTGGTCGGCGACGTGGATGTGGAACCAACATATCCCCAGA
CGGTGGACAGATCCGGCCTGCAACCACAACACAAAAATGTGCTCCTTAAC
AAATTGCCATACCAGGAACCTCACTCCTGGATTCATTTGACCGAGAAGTA
CCAGAGACAGGCATTCGGCCGGTATGGGGCCCAGAGCAATGTGAATCCCA
AGATTTGCTTCGATTCCCACGGAGAGAAAGACAGCAGGCAGGTTATGCAA
CTAGAAACACTCCTGAAAATGCTGGAGAAGAACCGCGCGCAGAAGGCAGA
GGAGCTGGCAAGGATAAATGCCCGTGAAGAGGACATTGCGAAGAAGATGG
AGAAGTTGACACAGTGGAAGGCGGACCTGCACGCGAAGATCGCTAAGCGG
GAGGCGGATGCAGCGGCAGCCATACAACGCAAGGAACGCCTGGTAGAGGA
GGTGCGCCGACACTTCGGGTTCAAGGTGGATACACGCGACGAACGCTTTA
AGGAAATGCTAGAGCAAAAAGAGAAGGAGGACAAGAAGAAGCAGAAGGAG
GCCAAGCGAAAGGCCAAGGAGGAGAAGATGATGGCCAAGCTGGTAGAGAA
AGCATCAGTGTAATATTTGTAGTATCAAAACCATCGATTTAAGCGAAGAA
CTGTTGTATGTTACACTAAAATAAAAACACTGCAAAAAGAAAAAAAAAAA
AAA

RH74410.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG7172-RA 854 CG7172-RA 19..854 4..839 4180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21556995..21557830 839..4 4180 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21568057..21568894 841..4 4190 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21561157..21561994 841..4 4190 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:58:55 has no hits.

RH74410.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:59:40 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21556995..21557833 1..839 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:54:16 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
CG7172-RA 1..699 65..763 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:06 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
CG7172-RA 1..699 65..763 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:56 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
CG7172-RA 1..699 65..763 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:35 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
CG7172-RA 1..699 65..763 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:16:28 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
CG7172-RA 1..699 65..763 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:43 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
CG7172-RA 16..854 1..839 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:06 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
CG7172-RA 16..854 1..839 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:56 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
CG7172-RA 2..840 1..839 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:35 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
CG7172-RA 1..836 4..839 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:16:28 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
CG7172-RA 2..840 1..839 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:40 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21568059..21568897 1..839 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:40 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21568059..21568897 1..839 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:40 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21568059..21568897 1..839 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:56 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21561159..21561997 1..839 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:11 Download gff for RH74410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21561159..21561997 1..839 99   Minus

RH74410.pep Sequence

Translation from 64 to 762

> RH74410.pep
MNVGKISVVTRLPALRSCAQYSSAAKAELPASLVGDVDVEPTYPQTVDRS
GLQPQHKNVLLNKLPYQEPHSWIHLTEKYQRQAFGRYGAQSNVNPKICFD
SHGEKDSRQVMQLETLLKMLEKNRAQKAEELARINAREEDIAKKMEKLTQ
WKADLHAKIAKREADAAAAIQRKERLVEEVRRHFGFKVDTRDERFKEMLE
QKEKEDKKKQKEAKRKAKEEKMMAKLVEKASV*

RH74410.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10700-PA 230 GF10700-PA 1..229 1..231 858 81.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:30:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13220-PA 231 GG13220-PA 1..231 1..231 1142 95.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:30:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14728-PA 232 GH14728-PA 1..232 1..231 724 61.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
CRIF-PA 232 CG7172-PA 1..232 1..232 1177 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:30:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13381-PA 231 GI13381-PA 20..231 21..231 699 67.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25171-PA 230 GL25171-PA 1..229 1..231 607 65.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22126-PA 232 GM22126-PA 1..231 1..231 1195 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12105-PA 230 GD12105-PA 1..229 1..231 1092 91.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:30:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11504-PA 231 GJ11504-PA 1..231 1..231 676 65.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:30:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18917-PA 238 GK18917-PA 7..238 8..232 641 62.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:30:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22314-PA 232 GE22314-PA 1..231 1..231 1111 92.6 Plus
Dyak\GE22709-PA 232 GE22709-PA 1..231 1..231 1111 92.6 Plus

RH74410.hyp Sequence

Translation from 64 to 762

> RH74410.hyp
MNVGKISVVTRLPALRSCAQYSSAAKAELPASLVGDVDVEPTYPQTVDRS
GLQPQHKNVLLNKLPYQEPHSWIHLTEKYQRQAFGRYGAQSNVNPKICFD
SHGEKDSRQVMQLETLLKMLEKNRAQKAEELARINAREEDIAKKMEKLTQ
WKADLHAKIAKREADAAAAIQRKERLVEEVRRHFGFKVDTRDERFKEMLE
QKEKEDKKKQKEAKRKAKEEKMMAKLVEKASV*

RH74410.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7172-PA 232 CG7172-PA 1..232 1..232 1177 100 Plus