BDGP Sequence Production Resources |
Search the DGRC for RH74701
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 747 |
Well: | 1 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG33155-RA |
Protein status: | RH74701.pep: gold |
Sequenced Size: | 926 |
Gene | Date | Evidence |
---|---|---|
mRpL53 | 2008-04-29 | Release 5.5 accounting |
CG33155 | 2008-08-15 | Release 5.9 accounting |
mRpL53 | 2008-08-15 | Release 5.9 accounting |
CG33155 | 2008-12-18 | 5.12 accounting |
mRpL53 | 2008-12-18 | 5.12 accounting |
926 bp (926 high quality bases) assembled on 2004-09-30
GenBank Submission: BT021211.1
> RH74701.complete GAATTTTCACGAAACCGAAAGGAAAAAGAAAATCATACTAAGAAGAAACT GAGAAAAACCAAAAAGGGTGCAGTGAAGTATTCACACCAGAAAAACCGAT CCTTCGAGGGCTAAAAAGGTGATGGGGTTGGGGAATGAAATAAATGCGTG CCACACTCACCGTAGACTTTCCCAATGATGCCCACGGTGGAGGTCATCTG GAGATCCGGAAAAGTCAGCGGCAGCGTGTGCGGATGGAGCTGAGCTGGCC CACCGGGAGCCAGCTCACGCTCCGTGGACATTTTAGTCGGTGTCGGCGTC AGTTTGAGGCGGCGTCGCTGCTCCTGAAAAATCAAGGAATTCCTCTTCCT GCTCTCCACACCCAAAGTGGCAGCTACGAATCCCAAGTGCGTGGTCAAGC CAGAAATCGTCTGCGATCGCCAGCCGGCCAACATCAAGTTTGCCCTGATT GATTCAGCGCAAGAACAAGCCCAAGTCAAGGAGATCCGCTTCAACAGCGA TAACCTAAACACACTAGAGCTGCTGCAGCTGTGCAACAAGCACGTGTCCA GCTTGGCACCGCGCGAGGAGATCACCAACAAGGTCCTGACCAAGGCGGAG AAACAGAAACTAGCAGGAGGCGCCGGCGGCGGAAAGAAGGCAACCAAGAA GAAGTAACCATCAGGATGGTGAGGAAGCACAAAGGAACACTGGCGGTGAT CGAGAAGATCTACCAGGATATACCCGCATTCTCCGACATCTTCACCGAGG AGAGCTTCTACATGTTCGCCTTCTGTTTCGTGTGCGCCACCATTCTGGTG GCCTTCATTCTCTCCCGGTTCATCACCATCAAGCCCGTCGATTTCTAAGC CAATTGTATTGTTCAATTCCGCACACGTACTTTTCAAAATATATATACGC TCTAACATGTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33155-RD | 918 | CG33155-RD | 1..916 | 1..916 | 4565 | 99.8 | Plus |
CG33155-RA | 730 | CG33155-RA | 148..728 | 336..916 | 2890 | 99.8 | Plus |
mRpL53-RA | 830 | mRpL53-RA | 248..828 | 336..916 | 2890 | 99.8 | Plus |
CG33155-RA | 730 | CG33155-RA | 30..148 | 1..119 | 595 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 9842548..9842996 | 462..910 | 2245 | 100 | Plus |
chr2R | 21145070 | chr2R | 9841862..9842197 | 1..336 | 1665 | 99.7 | Plus |
chr2R | 21145070 | chr2R | 9842248..9842379 | 332..463 | 645 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 13955213..13955667 | 462..916 | 2260 | 99.8 | Plus |
2R | 25286936 | 2R | 13954527..13954862 | 1..336 | 1680 | 100 | Plus |
2R | 25286936 | 2R | 13954913..13955044 | 332..463 | 645 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 13956412..13956866 | 462..916 | 2260 | 99.7 | Plus |
2R | 25260384 | 2R | 13955726..13956061 | 1..336 | 1680 | 100 | Plus |
2R | 25260384 | 2R | 13956112..13956243 | 332..463 | 645 | 99.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 9841862..9842196 | 1..335 | 99 | -> | Plus |
chr2R | 9842252..9842379 | 336..463 | 100 | -> | Plus |
chr2R | 9842550..9842996 | 464..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 147..468 | 336..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 147..468 | 336..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 147..468 | 336..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 147..468 | 336..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 147..468 | 336..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33155-RD | 1..910 | 1..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33155-RD | 1..910 | 1..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33155-RD | 30..939 | 1..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33155-RD | 30..939 | 1..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13954527..13954861 | 1..335 | 100 | -> | Plus |
2R | 13954917..13955044 | 336..463 | 100 | -> | Plus |
2R | 13955215..13955661 | 464..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13954527..13954861 | 1..335 | 100 | -> | Plus |
2R | 13954917..13955044 | 336..463 | 100 | -> | Plus |
2R | 13955215..13955661 | 464..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13954527..13954861 | 1..335 | 100 | -> | Plus |
2R | 13954917..13955044 | 336..463 | 100 | -> | Plus |
2R | 13955215..13955661 | 464..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 9842032..9842366 | 1..335 | 100 | -> | Plus |
arm_2R | 9842422..9842549 | 336..463 | 100 | -> | Plus |
arm_2R | 9842720..9843166 | 464..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13955726..13956060 | 1..335 | 100 | -> | Plus |
2R | 13956116..13956243 | 336..463 | 100 | -> | Plus |
2R | 13956414..13956860 | 464..910 | 100 | Plus |
Translation from 143 to 451
> RH74701.hyp MRATLTVDFPNDAHGGGHLEIRKSQRQRVRMELSWPTGSQLTLRGHFSRC RRQFEAASLLLKNQGIPLPALHTQSGSYESQVRGQARNRLRSPAGQHQVC PD*
Translation from 665 to 847
> RH74701.pep MVRKHKGTLAVIEKIYQDIPAFSDIFTEESFYMFAFCFVCATILVAFILS RFITIKPVDF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13721-PA | 60 | GF13721-PA | 1..60 | 1..60 | 288 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20413-PA | 60 | GG20413-PA | 1..60 | 1..60 | 303 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22825-PA | 60 | GH22825-PA | 1..60 | 1..60 | 291 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33155-PD | 60 | CG33155-PD | 1..60 | 1..60 | 308 | 100 | Plus |
CG33155-PC | 60 | CG33155-PC | 1..60 | 1..60 | 308 | 100 | Plus |
CG33155-PA | 60 | CG33155-PA | 1..60 | 1..60 | 308 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21203-PA | 60 | GI21203-PA | 1..60 | 1..60 | 288 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17400-PA | 60 | GL17400-PA | 1..60 | 1..60 | 291 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24814-PA | 60 | GA24814-PA | 1..60 | 1..60 | 291 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23257-PA | 60 | GM23257-PA | 1..60 | 1..60 | 303 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10994-PA | 60 | GD10994-PA | 1..60 | 1..60 | 303 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20805-PA | 60 | GJ20805-PA | 1..60 | 1..60 | 288 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18886-PA | 60 | GK18886-PA | 1..60 | 1..60 | 282 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12573-PA | 60 | GE12573-PA | 1..60 | 1..60 | 303 | 100 | Plus |