Clone RH74701 Report

Search the DGRC for RH74701

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:747
Well:1
Vector:pFlc-1
Associated Gene/TranscriptCG33155-RA
Protein status:RH74701.pep: gold
Sequenced Size:926

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpL53 2008-04-29 Release 5.5 accounting
CG33155 2008-08-15 Release 5.9 accounting
mRpL53 2008-08-15 Release 5.9 accounting
CG33155 2008-12-18 5.12 accounting
mRpL53 2008-12-18 5.12 accounting

Clone Sequence Records

RH74701.complete Sequence

926 bp (926 high quality bases) assembled on 2004-09-30

GenBank Submission: BT021211.1

> RH74701.complete
GAATTTTCACGAAACCGAAAGGAAAAAGAAAATCATACTAAGAAGAAACT
GAGAAAAACCAAAAAGGGTGCAGTGAAGTATTCACACCAGAAAAACCGAT
CCTTCGAGGGCTAAAAAGGTGATGGGGTTGGGGAATGAAATAAATGCGTG
CCACACTCACCGTAGACTTTCCCAATGATGCCCACGGTGGAGGTCATCTG
GAGATCCGGAAAAGTCAGCGGCAGCGTGTGCGGATGGAGCTGAGCTGGCC
CACCGGGAGCCAGCTCACGCTCCGTGGACATTTTAGTCGGTGTCGGCGTC
AGTTTGAGGCGGCGTCGCTGCTCCTGAAAAATCAAGGAATTCCTCTTCCT
GCTCTCCACACCCAAAGTGGCAGCTACGAATCCCAAGTGCGTGGTCAAGC
CAGAAATCGTCTGCGATCGCCAGCCGGCCAACATCAAGTTTGCCCTGATT
GATTCAGCGCAAGAACAAGCCCAAGTCAAGGAGATCCGCTTCAACAGCGA
TAACCTAAACACACTAGAGCTGCTGCAGCTGTGCAACAAGCACGTGTCCA
GCTTGGCACCGCGCGAGGAGATCACCAACAAGGTCCTGACCAAGGCGGAG
AAACAGAAACTAGCAGGAGGCGCCGGCGGCGGAAAGAAGGCAACCAAGAA
GAAGTAACCATCAGGATGGTGAGGAAGCACAAAGGAACACTGGCGGTGAT
CGAGAAGATCTACCAGGATATACCCGCATTCTCCGACATCTTCACCGAGG
AGAGCTTCTACATGTTCGCCTTCTGTTTCGTGTGCGCCACCATTCTGGTG
GCCTTCATTCTCTCCCGGTTCATCACCATCAAGCCCGTCGATTTCTAAGC
CAATTGTATTGTTCAATTCCGCACACGTACTTTTCAAAATATATATACGC
TCTAACATGTAAAAAAAAAAAAAAAA

RH74701.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG33155-RD 918 CG33155-RD 1..916 1..916 4565 99.8 Plus
CG33155-RA 730 CG33155-RA 148..728 336..916 2890 99.8 Plus
mRpL53-RA 830 mRpL53-RA 248..828 336..916 2890 99.8 Plus
CG33155-RA 730 CG33155-RA 30..148 1..119 595 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9842548..9842996 462..910 2245 100 Plus
chr2R 21145070 chr2R 9841862..9842197 1..336 1665 99.7 Plus
chr2R 21145070 chr2R 9842248..9842379 332..463 645 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13955213..13955667 462..916 2260 99.8 Plus
2R 25286936 2R 13954527..13954862 1..336 1680 100 Plus
2R 25286936 2R 13954913..13955044 332..463 645 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13956412..13956866 462..916 2260 99.7 Plus
2R 25260384 2R 13955726..13956061 1..336 1680 100 Plus
2R 25260384 2R 13956112..13956243 332..463 645 99.2 Plus
Blast to na_te.dros performed on 2019-03-16 10:19:11 has no hits.

RH74701.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:19:52 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9841862..9842196 1..335 99 -> Plus
chr2R 9842252..9842379 336..463 100 -> Plus
chr2R 9842550..9842996 464..910 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:54:20 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 147..468 336..657 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:31:54 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 147..468 336..657 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:32:39 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 147..468 336..657 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:15:42 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 147..468 336..657 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:05:19 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 147..468 336..657 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:33 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RD 1..910 1..910 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:31:54 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RD 1..910 1..910 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:32:39 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RD 30..939 1..910 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:05:19 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RD 30..939 1..910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:19:52 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13954527..13954861 1..335 100 -> Plus
2R 13954917..13955044 336..463 100 -> Plus
2R 13955215..13955661 464..910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:19:52 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13954527..13954861 1..335 100 -> Plus
2R 13954917..13955044 336..463 100 -> Plus
2R 13955215..13955661 464..910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:19:52 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13954527..13954861 1..335 100 -> Plus
2R 13954917..13955044 336..463 100 -> Plus
2R 13955215..13955661 464..910 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:32:39 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9842032..9842366 1..335 100 -> Plus
arm_2R 9842422..9842549 336..463 100 -> Plus
arm_2R 9842720..9843166 464..910 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:52:40 Download gff for RH74701.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13955726..13956060 1..335 100 -> Plus
2R 13956116..13956243 336..463 100 -> Plus
2R 13956414..13956860 464..910 100   Plus

RH74701.hyp Sequence

Translation from 143 to 451

> RH74701.hyp
MRATLTVDFPNDAHGGGHLEIRKSQRQRVRMELSWPTGSQLTLRGHFSRC
RRQFEAASLLLKNQGIPLPALHTQSGSYESQVRGQARNRLRSPAGQHQVC
PD*
Sequence RH74701.hyp has no blast hits.

RH74701.pep Sequence

Translation from 665 to 847

> RH74701.pep
MVRKHKGTLAVIEKIYQDIPAFSDIFTEESFYMFAFCFVCATILVAFILS
RFITIKPVDF*

RH74701.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13721-PA 60 GF13721-PA 1..60 1..60 288 93.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20413-PA 60 GG20413-PA 1..60 1..60 303 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22825-PA 60 GH22825-PA 1..60 1..60 291 93.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG33155-PD 60 CG33155-PD 1..60 1..60 308 100 Plus
CG33155-PC 60 CG33155-PC 1..60 1..60 308 100 Plus
CG33155-PA 60 CG33155-PA 1..60 1..60 308 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21203-PA 60 GI21203-PA 1..60 1..60 288 93.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17400-PA 60 GL17400-PA 1..60 1..60 291 95 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24814-PA 60 GA24814-PA 1..60 1..60 291 95 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23257-PA 60 GM23257-PA 1..60 1..60 303 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10994-PA 60 GD10994-PA 1..60 1..60 303 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20805-PA 60 GJ20805-PA 1..60 1..60 288 91.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18886-PA 60 GK18886-PA 1..60 1..60 282 93.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12573-PA 60 GE12573-PA 1..60 1..60 303 100 Plus