Clone RT01009 Report

Search the DGRC for RT01009

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:10
Well:9
Vector:pCR2.1
Associated Gene/TranscriptCrebB-RF
Protein status:RT01009.pep: gold
Sequenced Size:890

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6103 2006-05-19 RT target
CrebB-17A 2008-04-29 Release 5.5 accounting
CrebB-17A 2008-08-15 Release 5.9 accounting
CrebB-17A 2008-12-18 5.12 accounting

Clone Sequence Records

RT01009.complete Sequence

890 bp (890 high quality bases) assembled on 2008-07-29

GenBank Submission: BT028813

> RT01009.complete
GAAGTTATCAGTCGACATGGACAACAGCATCGTCGAGGAGAACGGCAACT
CGTCGGCGGCATCGGGCTCCAATGACGTGGTCGATGTCGTTGCCCAACAG
GCGGCGGCAGCGGTGGGCGGCGGCGGTGGAGGAGGAGGAGGCGGCGGCGG
TGGTAACCCCCAGCAGCAGCAACAGAACCCACAAAGTACAACGGCCGGCG
GTCCAACGGGTGCGACGAACAACGCCCAGGGAGGCGGAGTGTCCTCCGTG
CTGACCACCACCGCCAACTGCAACATACAATACCCCATCCAGACGCTGGC
GCAGCACGGACTGCAGGTGCAGTCCGTGATACAGGCCAATCCCTCGGGAG
TCATACAGACAGCAGCTGGAACCCAGCAGCAGCAACAGGCGCTGGCCGCC
GCCACAGCGATGCAGAAGGTGGTCTACGTGGCCAAGCCGCCGAACTCGAC
GGTCATCCACACGACGCCTGGCAATGCAGTGCAAGTGCGTAACAAAATCC
CTCCAACCTTTCCGTGTAAGATCAAGCCCGAACCGAACACGCAGCACCCG
GAGGACAGCGACGAGAGTCTGTCGGACGACGATTCCCAGCACCACCGCAG
CGAGCTGACGCGACGGCCGTCGTACAATAAGATCTTCACCGAGATCAGCG
GTCCGGACATGAGCGACAACAGCGGGATAGCGGAGGATCAGACCCGTAAG
CGCGAGATCCGGCTGCAGAAGAACAGGGAGGCGGCGCGTGAGTGCCGGCG
CAAGAAGAAGGAGTACATCAAGTGCCTGGAGAATCGAGTGGCGGTGCTAG
AGAACCAAAACAAAGCGCTCATCGAGGAGCTGAAGTCGCTCAAGGAGCTC
TACTGTCAGACCAAGAACGATTGAAAGCTTTATCGACCAT

RT01009.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
CrebB-17A.o 2111 CrebB-17A.o 767..1627 15..875 4305 100 Plus
CrebB-17A.b 2449 CrebB-17A.b 767..1627 15..875 4305 100 Plus
CrebB-17A-RE 1095 CrebB-17A-RE 400..748 317..665 1745 100 Plus
CrebB-17A-RE 1095 CrebB-17A-RE 14..318 15..319 1525 100 Plus
CrebB-17A-RE 1095 CrebB-17A-RE 887..1095 666..874 1045 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18261308..18261612 15..319 1525 100 Plus
chrX 22417052 chrX 18265021..18265231 665..875 1055 100 Plus
chrX 22417052 chrX 18262207..18262390 313..496 920 100 Plus
chrX 22417052 chrX 18262464..18262632 497..665 845 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:39:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18372131..18372435 15..319 1525 100 Plus
X 23542271 X 18375842..18376052 665..875 1055 100 Plus
X 23542271 X 18373030..18373213 313..496 920 100 Plus
X 23542271 X 18373287..18373455 497..665 845 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18380229..18380533 15..319 1525 100 Plus
X 23527363 X 18383940..18384150 665..875 1055 100 Plus
X 23527363 X 18381128..18381311 313..496 920 100 Plus
X 23527363 X 18381385..18381553 497..665 845 100 Plus
Blast to na_te.dros performed 2019-03-15 21:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..7001 161..392 140 59.2 Plus
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 7876..8008 558..689 112 60.9 Plus

RT01009.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:06:54 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18261447..18261609 154..316 100 -> Plus
chrX 18262211..18262390 317..496 100 -> Plus
chrX 18262464..18262632 497..665 100 -> Plus
chrX 18265022..18265231 666..875 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:54:35 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RH 1..858 17..874 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:04 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RH 1..858 17..874 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:37:30 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-RF 1..858 17..874 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:47:58 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RH 1..858 17..874 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:43:24 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-RF 1..858 17..874 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:33:55 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RH 1..873 1..874 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:04 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RH 1..873 1..874 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:37:30 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-RF 295..1165 3..875 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:47:57 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RH 1..873 1..874 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:24 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-RF 437..1307 3..875 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:54 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
X 18372121..18372432 3..316 98 -> Plus
X 18373034..18373213 317..496 100 -> Plus
X 18373287..18373455 497..665 100 -> Plus
X 18375843..18376052 666..875 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:54 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
X 18372121..18372432 3..316 98 -> Plus
X 18373034..18373213 317..496 100 -> Plus
X 18373287..18373455 497..665 100 -> Plus
X 18375843..18376052 666..875 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:54 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
X 18372121..18372432 3..316 98 -> Plus
X 18373034..18373213 317..496 100 -> Plus
X 18373287..18373455 497..665 100 -> Plus
X 18375843..18376052 666..875 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:37:30 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18266154..18266465 3..316 98 -> Plus
arm_X 18267067..18267246 317..496 100 -> Plus
arm_X 18267320..18267488 497..665 100 -> Plus
arm_X 18269876..18270085 666..875 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:32 Download gff for RT01009.complete
Subject Subject Range Query Range Percent Splice Strand
X 18380219..18380530 3..316 98 -> Plus
X 18381132..18381311 317..496 100 -> Plus
X 18381385..18381553 497..665 100 -> Plus
X 18383941..18384150 666..875 100   Plus

RT01009.pep Sequence

Translation from 1 to 873

> RT01009.pep
KLSVDMDNSIVEENGNSSAASGSNDVVDVVAQQAAAAVGGGGGGGGGGGG
GNPQQQQQNPQSTTAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLA
QHGLQVQSVIQANPSGVIQTAAGTQQQQQALAAATAMQKVVYVAKPPNST
VIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHRS
ELTRRPSYNKIFTEISGPDMSDNSGIAEDQTRKREIRLQKNREAARECRR
KKKEYIKCLENRVAVLENQNKALIEELKSLKELYCQTKND*

RT01009.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22432-PA 203 GF22432-PA 9..203 140..290 626 72.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19161-PA 330 GG19161-PA 1..330 6..290 997 79.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17726-PA 376 GH17726-PA 70..248 63..221 495 67.7 Plus
Dgri\GH17726-PA 376 GH17726-PA 307..376 221..290 356 94.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
CrebB-PF 285 CG6103-PF 1..285 6..290 1471 100 Plus
CrebB-PP 281 CG6103-PP 1..281 6..290 1436 98.6 Plus
CrebB-PO 281 CG6103-PO 1..281 6..290 1436 98.6 Plus
CrebB-PJ 281 CG6103-PJ 1..281 6..290 1436 98.6 Plus
CrebB-PQ 331 CG6103-PQ 1..331 6..290 1409 85.8 Plus
CrebB-PN 327 CG6103-PN 1..327 6..290 1374 84.6 Plus
CrebB-PI 327 CG6103-PI 1..327 6..290 1374 84.6 Plus
CrebB-PG 327 CG6103-PG 1..327 6..290 1374 84.6 Plus
CrebB-PM 296 CG6103-PM 1..220 6..225 1129 99.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15475-PA 365 GI15475-PA 1..365 6..290 808 58.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26969-PA 323 GL26969-PA 1..323 6..290 850 66 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22328-PA 318 GA22328-PA 1..318 6..290 900 67.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22894-PA 310 GM22894-PA 31..310 55..290 972 78.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17392-PA 315 GD17392-PA 1..310 6..271 1253 81.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19187-PA 242 GJ19187-PA 1..224 6..221 464 64.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20005-PA 337 GK20005-PA 76..337 83..290 738 71.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17723-PA 324 GE17723-PA 1..324 6..290 1012 81 Plus

RT01009.hyp Sequence

Translation from 3 to 873

> RT01009.hyp
RIGNMDNSIVEENGNSSAASGSNDVVDVVAQQAAAAVGGGGGGGGGGGGG
NPQQQQQNPQSTTAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLAQ
HGLQVQSVIQANPSGVIQTAAGTQQQQQALAAATAMQKVVYVAKPPNSTV
IHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHRSE
LTRRPSYNKIFTEISGPDMSDNSGIAEDQTRKREIRLQKNREAARECRRK
KKEYIKCLENRVAVLENQNKALIEELKSLKELYCQTKND*

RT01009.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
CrebB-PF 285 CG6103-PF 1..285 5..289 1471 100 Plus
CrebB-PP 281 CG6103-PP 1..281 5..289 1436 98.6 Plus
CrebB-PO 281 CG6103-PO 1..281 5..289 1436 98.6 Plus
CrebB-PJ 281 CG6103-PJ 1..281 5..289 1436 98.6 Plus
CrebB-PN 327 CG6103-PN 1..327 5..289 1374 84.6 Plus