Clone RT01029 Report

Search the DGRC for RT01029

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:10
Well:29
Vector:pCR2.1
Associated Gene/TranscriptCG2709-RA
Protein status:RT01029.pep: gold
Sequenced Size:741

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2709 2006-05-19 RT target
CG2709 2008-04-29 Release 5.5 accounting
CG2709 2008-08-15 Release 5.9 accounting
CG2709 2008-12-18 5.12 accounting

Clone Sequence Records

RT01029.complete Sequence

741 bp (741 high quality bases) assembled on 2008-07-28

GenBank Submission: BT028822

> RT01029.complete
TTATAGTCGACATGGCGAAATCACAAGCAGGTCAGACTGTCGAGCCGGAG
GCGTCCAAGCTGTGGATCCACTGCAACAGCTGCTGCGCCCTGTTCTGCGA
TAAGAAGCACACCTTCTTCCTGCTCGCCTGCCATCACGTGTTCTGCGAGC
GGTGCGTCAAGGTCTCCGCCGGCCGCACGCCCAGCGACGCGCCCATATTC
GAATGCTCCACCTGTCGGCGGAGCGTGCGCGGCCGCCAGTTGACCAACTC
GATGCCCAACCACTTCAAGCAGCTCTTCCATCCGGAGCCCTTCACCATCG
GCAACGACTTTGTGGAGACGTTCCAGCGCGGCAATCATCGGCACTTCGAC
AAGTACAAGGAGAGGAAGGAACTGGAGATGGATAAGCTGTTCAAGGACAT
CGAGGTGGCCAAGTCCGTGTGCCAGAAACGCTTCCTGGAGGCGCAGATGC
TGCGCGTGGAGCGCAAGAAGCTGATGCAGAGGTCGCGCTACATTAAGGCG
GAAGTCGCCAATCGGAAGGCGGAAATGCATCGGATGGCCCAGGCCTACCG
AAGCCGCTCGCTGACTTCGCAATCCTCGTCATCCGCCCAACGCTCGGCGC
GCGGACGTCCTCGTGGCCGTGGAACAGCCACACAGTCCTCCAGTCGACGC
CGATCAACGGAATCAGCAAAGCGGCAGCAAATCACCAGCTTCATACACCC
GCCGAACAACTCGTTCGATCTGTGAAAGCTTTATCGACCAT

RT01029.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG2709-RA 913 CG2709-RA 114..828 11..725 3575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2620522..2621044 11..533 2615 100 Plus
chrX 22417052 chrX 2621107..2621300 532..725 970 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:40:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2726706..2727228 11..533 2615 100 Plus
X 23542271 X 2727291..2727484 532..725 970 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2734804..2735326 11..533 2615 100 Plus
X 23527363 X 2735389..2735582 532..725 970 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:46:10 has no hits.

RT01029.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:47:10 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2620516..2621043 5..532 99 -> Plus
chrX 2621108..2621303 533..730 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:54:52 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
CG2709-RA 1..714 12..725 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:24 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
CG2709-RA 1..714 12..725 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:30:16 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
CG2709-RA 1..714 12..725 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:44:51 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
CG2709-RA 1..714 12..725 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:59:55 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
CG2709-RA 1..714 12..725 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:23:04 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
CG2709-RA 1..719 12..728 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:24 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
CG2709-RA 1..719 12..728 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:30:16 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
CG2709-RA 1..719 12..728 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:44:50 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
CG2709-RA 1..719 12..728 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:59:55 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
CG2709-RA 23..746 5..730 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:10 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
X 2727292..2727487 533..730 98   Plus
X 2726700..2727227 5..532 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:10 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
X 2727292..2727487 533..730 98   Plus
X 2726700..2727227 5..532 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:10 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
X 2727292..2727487 533..730 98   Plus
X 2726700..2727227 5..532 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:30:16 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2621325..2621520 533..730 98   Plus
arm_X 2620733..2621260 5..532 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:31:28 Download gff for RT01029.complete
Subject Subject Range Query Range Percent Splice Strand
X 2734798..2735325 5..532 99 -> Plus
X 2735390..2735585 533..730 98   Plus

RT01029.pep Sequence

Translation from 2 to 724

> RT01029.pep
IVDMAKSQAGQTVEPEASKLWIHCNSCCALFCDKKHTFFLLACHHVFCER
CVKVSAGRTPSDAPIFECSTCRRSVRGRQLTNSMPNHFKQLFHPEPFTIG
NDFVETFQRGNHRHFDKYKERKELEMDKLFKDIEVAKSVCQKRFLEAQML
RVERKKLMQRSRYIKAEVANRKAEMHRMAQAYRSRSLTSQSSSSAQRSAR
GRPRGRGTATQSSSRRRSTESAKRQQITSFIHPPNNSFDL*

RT01029.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22483-PA 231 GF22483-PA 2..231 16..240 560 50.2 Plus
Dana\GF21626-PA 256 GF21626-PA 27..256 16..240 560 50.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18626-PA 244 GG18626-PA 1..244 4..240 1062 81.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17758-PA 194 GH17758-PA 4..164 17..181 347 40.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:02
Subject Length Description Subject Range Query Range Score Percent Strand
vilya-PA 237 CG2709-PA 1..237 4..240 1250 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15091-PA 261 GI15091-PA 17..261 16..240 395 36.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19917-PA 246 GL19917-PA 11..246 7..240 613 52.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15440-PA 246 GA15440-PA 11..246 7..240 619 52.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19246-PA 240 GM19246-PA 1..240 4..240 1207 95.4 Plus
Dsec\GM11047-PA 240 GM11047-PA 1..240 4..240 1207 95.4 Plus
Dsec\GM16934-PA 153 GM16934-PA 1..132 4..135 714 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18899-PA 245 GJ18899-PA 15..245 14..240 433 40.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25599-PA 242 GK25599-PA 37..242 15..240 360 34.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16279-PA 246 GE16279-PA 1..246 4..240 916 78.5 Plus

RT01029.hyp Sequence

Translation from 5 to 724

> RT01029.hyp
APMAKSQAGQTVEPEASKLWIHCNSCCALFCDKKHTFFLLACHHVFCERC
VKVSAGRTPSDAPIFECSTCRRSVRGRQLTNSMPNHFKQLFHPEPFTIGN
DFVETFQRGNHRHFDKYKERKELEMDKLFKDIEVAKSVCQKRFLEAQMLR
VERKKLMQRSRYIKAEVANRKAEMHRMAQAYRSRSLTSQSSSSAQRSARG
RPRGRGTATQSSSRRRSTESAKRQQITSFIHPPNNSFDL*

RT01029.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG2709-PA 237 CG2709-PA 1..237 3..239 1250 100 Plus