Clone RT01030 Report

Search the DGRC for RT01030

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:10
Well:30
Vector:pCR2.1
Associated Gene/TranscriptHLH54F-RA
Protein status:RT01030.pep: gold
Sequenced Size:761

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5005 2006-05-19 RT target
HLH54F 2008-04-29 Release 5.5 accounting
HLH54F 2008-08-15 Release 5.9 accounting
HLH54F 2008-12-18 5.12 accounting

Clone Sequence Records

RT01030.complete Sequence

761 bp (761 high quality bases) assembled on 2008-07-29

GenBank Submission: BT028823

> RT01030.complete
GAAGTTATCAGTCGACATGCCACGCAAGAAGCGCAGTTCCAGCCCCACGG
AGTTCTTTGATGACGACTTCGATGAGGATGCCAGTTCTCAAAGCTCCCAA
CCGCCGGTGCAGCGAAATGCGGCAAATGCCCGGGAGCGGATGCGTATGCG
GGTTTTATCCAGCGCCTACGGACGTTTGAAGACCAAGCTGCCCAACATTC
CGCCGGACACGAAGCTCTCCAAGTTGGACACGTTGCGTTTGGCCACGCTC
TACATCAAGCAGCTAATTACGGCTGTGGAGACAGGCAGCCACTCGCAGAA
CCACCCGCACAACCACAACCAGCACCACAGCCTCAACCACAGTCACTCGA
GTACCACCAGTTCCGAAGGCCTGGACACAAGTCACATGGCAGATTCGTCC
GGTGGAGGCAATTATAATTTCCACAACAACGGACACGGCATGAGCTGGCC
CTTTGAGTTCCACCAGAGTAGCCGGAGTTTGGCATTTGCCCCATCATCAT
CAACCACCTCATCCGCCCGTATGGATTGGCAAACCCTGCATACGCAATCT
TATCCGAAGACTACGCGAGGCGAAACCCATGTTTCGGCGGATCTAAGTTA
CCATCAGTTGCCGGAATCTCACAGTCACTGGTATCCGGCGGAAGTGCATC
AAATGGAGCCAGCGGCCAGCTGTTCCTATGACTCTGGAATGGGGCAGCAT
CAGCGGGGCATAGCTATAGCCACTAGCCATGCCCATGGCATTTAAAAGCT
TTATCGACCAT

RT01030.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
HLH54F-RA 1348 HLH54F-RA 321..1049 17..745 3645 100 Plus
HLH54F.b 1662 HLH54F.b 755..1483 17..745 3645 100 Plus
HLH54F.a 1089 HLH54F.a 258..910 93..745 3265 100 Plus
HLH54F.a 1089 HLH54F.a 159..235 17..93 385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13645213..13645562 93..442 1750 100 Plus
chr2R 21145070 chr2R 13647170..13647473 442..745 1490 99.3 Plus
chr2R 21145070 chr2R 13644701..13644777 17..93 385 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:40:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17758087..17758436 93..442 1750 100 Plus
2R 25286936 2R 17760035..17760338 442..745 1520 100 Plus
2R 25286936 2R 17757575..17757651 17..93 385 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17759286..17759635 93..442 1750 100 Plus
2R 25260384 2R 17761234..17761537 442..745 1520 100 Plus
2R 25260384 2R 17758774..17758850 17..93 385 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:47:38 has no hits.

RT01030.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:48:46 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13644701..13644776 17..92 100 -> Plus
chr2R 13645213..13645562 93..442 100 -> Plus
chr2R 13647171..13647475 443..749 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:54:53 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
HLH54F-RA 1..729 17..745 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:35 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
HLH54F-RA 1..729 17..745 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:31 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
HLH54F-RA 1..729 17..745 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:47:33 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
HLH54F-RA 1..729 17..745 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:13 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
HLH54F-RA 1..729 17..745 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:49 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
HLH54F-RA 159..889 17..749 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:35 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
HLH54F-RA 159..889 17..749 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:31 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
HLH54F-RA 171..901 17..749 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:47:33 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
HLH54F-RA 159..889 17..749 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:13 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
HLH54F-RA 171..901 17..749 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:46 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17760036..17760340 443..749 99   Plus
2R 17757575..17757650 17..92 100 -> Plus
2R 17758087..17758436 93..442 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:46 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17760036..17760340 443..749 99   Plus
2R 17757575..17757650 17..92 100 -> Plus
2R 17758087..17758436 93..442 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:46 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17760036..17760340 443..749 99   Plus
2R 17757575..17757650 17..92 100 -> Plus
2R 17758087..17758436 93..442 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:31 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13645080..13645155 17..92 100 -> Plus
arm_2R 13645592..13645941 93..442 100 -> Plus
arm_2R 13647541..13647845 443..749 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:54 Download gff for RT01030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17759286..17759635 93..442 100 -> Plus
2R 17761235..17761539 443..749 99   Plus
2R 17758774..17758849 17..92 100 -> Plus

RT01030.pep Sequence

Translation from 1 to 744

> RT01030.pep
KLSVDMPRKKRSSSPTEFFDDDFDEDASSQSSQPPVQRNAANARERMRMR
VLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQN
HPHNHNQHHSLNHSHSSTTSSEGLDTSHMADSSGGGNYNFHNNGHGMSWP
FEFHQSSRSLAFAPSSSTTSSARMDWQTLHTQSYPKTTRGETHVSADLSY
HQLPESHSHWYPAEVHQMEPAASCSYDSGMGQHQRGIAIATSHAHGI*

RT01030.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11672-PA 238 GF11672-PA 1..238 6..247 898 79.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21821-PA 241 GG21821-PA 1..241 6..247 1059 91.3 Plus
Dere\GG23955-PA 174 GG23955-PA 59..115 37..93 157 47.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22024-PA 250 GH22024-PA 1..250 6..247 582 60 Plus
Dgri\GH13020-PA 175 GH13020-PA 63..119 37..93 152 45.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
HLH54F-PA 242 CG5005-PA 1..242 6..247 1297 100 Plus
Hand-PA 174 CG18144-PA 59..115 37..93 150 47.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19113-PA 246 GI19113-PA 1..246 6..247 671 58.9 Plus
Dmoj\GI18263-PA 170 GI18263-PA 59..115 37..93 153 45.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17221-PA 233 GL17221-PA 1..232 6..247 784 71.1 Plus
Dper\GL18976-PA 173 GL18976-PA 58..109 37..88 148 51.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18588-PB 233 GA18588-PB 1..232 6..247 788 71.9 Plus
Dpse\GA14815-PA 173 GA14815-PA 58..109 37..88 148 51.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21822-PA 242 GM21822-PA 1..242 6..247 1254 97.5 Plus
Dsec\GM11834-PA 171 GM11834-PA 56..112 37..93 156 47.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11315-PA 242 GD11315-PA 1..242 6..247 1250 97.1 Plus
Dsim\GD22284-PA 174 GD22284-PA 59..115 37..93 157 47.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22243-PA 245 GJ22243-PA 1..245 6..247 642 58.3 Plus
Dvir\GJ17522-PA 133 GJ17522-PA 22..78 37..93 149 45.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22890-PA 262 GK22890-PA 1..251 6..233 531 57.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11898-PA 249 GE11898-PA 1..249 6..247 927 85.1 Plus
Dyak\GE26185-PA 174 GE26185-PA 59..115 37..93 156 47.4 Plus

RT01030.hyp Sequence

Translation from 17 to 744

> RT01030.hyp
MPRKKRSSSPTEFFDDDFDEDASSQSSQPPVQRNAANARERMRMRVLSSA
YGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQNHPHNH
NQHHSLNHSHSSTTSSEGLDTSHMADSSGGGNYNFHNNGHGMSWPFEFHQ
SSRSLAFAPSSSTTSSARMDWQTLHTQSYPKTTRGETHVSADLSYHQLPE
SHSHWYPAEVHQMEPAASCSYDSGMGQHQRGIAIATSHAHGI*

RT01030.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
HLH54F-PA 242 CG5005-PA 1..242 1..242 1297 100 Plus
Hand-PA 174 CG18144-PA 59..115 32..88 150 47.4 Plus