Clone RT01041 Report

Search the DGRC for RT01041

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:10
Well:41
Vector:pCR2.1
Associated Gene/TranscriptE(spl)m8-HLH-RA
Protein status:RT01041.pep: gold
Sequenced Size:572

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8365 2006-05-19 RT target
E(spl) 2008-04-29 Release 5.5 accounting
E(spl) 2008-08-15 Release 5.9 accounting
E(spl) 2008-12-18 5.12 accounting

Clone Sequence Records

RT01041.complete Sequence

572 bp (572 high quality bases) assembled on 2008-07-28

GenBank Submission: BT028829

> RT01041.complete
GAAGTTATCAGTCGACATGGAATACACCACCAAGACCCAGATCTACCAGA
AGGTGAAGAAGCCAATGCTGGAGCGCCAGCGACGTGCCCGCATGAACAAG
TGCCTGGACAACCTGAAAACACTTGTCGCCGAGCTACGAGGTGATGATGG
CATCCTGCGCATGGACAAGGCCGAGATGCTCGAGTCAGCGGTGATCTTCA
TGCGCCAGCAAAAGACACCAAAGAAGGTGGCTCAGGAAGAACAATCCCTC
CCCCTGGACAGCTTTAAGAATGGCTACATGAATGCCGTCAACGAGGTGTC
ACGTGTCATGGCCTCCACACCTGGCATGAGCGTCGACCTGGGCAAATCGG
TGATGACTCACCTGGGACGCGTCTACAAGAACTTGCAGCAATTCCACGAA
GCACAGTCCGCCGCCGACTTCATCCAGAACTCGATGGACTGCTCCTCAAT
GGACAAGGCTCCGCTCAGCCCCGCCTCCTCCGGATATCACAGCGACTGCG
ACAGCCCCGCCCCCTCGCCACAGCCCATGCAGCAGCCCTTGTGGCGCCCC
TGGTAGAAGCTTTATCGACCAT

RT01041.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)-RA 546 E(spl)-RA 3..541 17..555 2695 100 Plus
HLHm5-RA 886 HLHm5-RA 121..296 30..205 370 80.6 Plus
HLHm5-RA 886 HLHm5-RA 336..451 251..366 250 81 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21863307..21863845 17..555 2695 100 Plus
chr3R 27901430 chr3R 21852431..21852606 205..30 370 80.7 Minus
chr3R 27901430 chr3R 21852276..21852387 366..255 245 81.2 Minus
chr3R 27901430 chr3R 21828778..21828837 109..50 180 86.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:40:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26040324..26040862 17..555 2695 100 Plus
3R 32079331 3R 26029285..26029615 366..30 385 75.7 Minus
3R 32079331 3R 26005792..26005851 109..50 180 86.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25781155..25781693 17..555 2695 100 Plus
3R 31820162 3R 25770271..25770446 205..30 370 80.6 Minus
3R 31820162 3R 25770116..25770231 366..251 250 81 Minus
Blast to na_te.dros performed on 2019-03-16 05:03:50 has no hits.

RT01041.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:04:41 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21863307..21863847 17..558 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:55:02 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)-RA 1..540 17..557 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:47 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)-RA 1..540 17..557 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:21 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m8-HLH-RA 1..540 17..557 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:46:35 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)-RA 1..540 17..557 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:55:34 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m8-HLH-RA 1..540 17..557 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:23:50 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)-RA 1..540 17..557 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:47 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)-RA 70..610 17..558 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:21 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m8-HLH-RA 85..625 17..558 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:46:35 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)-RA 1..540 17..557 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:55:34 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m8-HLH-RA 85..625 17..558 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:41 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26040324..26040864 17..558 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:41 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26040324..26040864 17..558 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:41 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26040324..26040864 17..558 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:21 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21866046..21866586 17..558 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:31:58 Download gff for RT01041.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25781155..25781695 17..558 99   Plus

RT01041.pep Sequence

Translation from 1 to 555

> RT01041.pep
KLSVDMEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDG
ILRMDKAEMLESAVIFMRQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVS
RVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSM
DKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW*

RT01041.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16802-PA 180 GF16802-PA 1..180 6..184 763 81.2 Plus
Dana\GF18222-PA 182 GF18222-PA 12..182 8..184 523 58.5 Plus
Dana\GF18225-PA 200 GF18225-PA 1..196 2..184 286 38.2 Plus
Dana\GF16796-PA 205 GF16796-PA 11..166 11..160 281 42.6 Plus
Dana\GF16801-PA 180 GF16801-PA 8..180 10..184 278 43.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11459-PA 179 GG11459-PA 1..179 6..184 946 97.2 Plus
Dere\GG12204-PA 178 GG12204-PA 11..178 8..184 539 60.3 Plus
Dere\GG12207-PA 195 GG12207-PA 1..195 2..184 295 38.4 Plus
Dere\GG11450-PA 205 GG11450-PA 3..134 3..129 290 47 Plus
Dere\GG11458-PA 186 GG11458-PA 8..186 10..184 277 41.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19459-PA 193 GH19459-PA 1..193 6..184 704 69.9 Plus
Dgri\GH18145-PA 187 GH18145-PA 9..187 8..184 514 58.6 Plus
Dgri\GH19458-PA 207 GH19458-PA 8..207 10..184 298 37.5 Plus
Dgri\GH18148-PA 210 GH18148-PA 3..210 4..184 281 36.8 Plus
Dgri\GH19452-PA 217 GH19452-PA 11..135 11..129 274 48 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)m8-HLH-PA 179 CG8365-PA 1..179 6..184 933 100 Plus
E(spl)m5-HLH-PA 178 CG6096-PA 11..178 8..184 521 60.9 Plus
E(spl)m7-HLH-PA 186 CG8361-PA 8..186 10..184 306 40.7 Plus
E(spl)mgamma-HLH-PA 205 CG8333-PA 3..205 3..184 293 35 Plus
E(spl)mbeta-HLH-PA 195 CG14548-PA 8..195 10..184 291 38.1 Plus
E(spl)mdelta-HLH-PA 173 CG8328-PA 8..173 8..184 241 33.9 Plus
E(spl)m3-HLH-PA 224 CG8346-PA 6..224 10..184 193 27.7 Plus
dpn-PA 435 CG8704-PA 41..208 16..174 160 25.6 Plus
h-PB 337 CG6494-PB 32..171 16..157 154 28.8 Plus
h-PA 337 CG6494-PA 32..171 16..157 154 28.8 Plus
Hesr-PA 149 CG5927-PA 16..116 10..103 139 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24693-PA 173 GI24693-PA 1..173 6..184 727 76.9 Plus
Dmoj\GI22907-PA 183 GI22907-PA 9..183 8..184 492 57 Plus
Dmoj\GI24692-PA 207 GI24692-PA 8..207 10..184 292 38.1 Plus
Dmoj\GI22910-PA 210 GI22910-PA 1..210 2..184 280 37.4 Plus
Dmoj\GI24686-PA 217 GI24686-PA 3..135 3..129 274 45.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21823-PA 186 GL21823-PA 1..186 6..184 686 77.4 Plus
Dper\GL22018-PA 186 GL22018-PA 12..186 8..184 470 55.9 Plus
Dper\GL22021-PA 200 GL22021-PA 1..200 2..184 286 37.3 Plus
Dper\GL21815-PA 214 GL21815-PA 10..166 10..160 282 43.8 Plus
Dper\GL21813-PA 188 GL21813-PA 8..188 8..184 235 29.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21022-PA 186 GA21022-PA 1..186 6..184 691 78 Plus
Dpse\GA19349-PA 187 GA19349-PA 7..187 3..184 464 54.6 Plus
Dpse\GA13073-PA 200 GA13073-PA 1..200 2..184 286 37.3 Plus
Dpse\GA20996-PA 214 GA20996-PA 10..166 10..160 281 43.8 Plus
Dpse\GA20991-PA 188 GA20991-PA 8..188 8..184 235 29.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10301-PA 179 GM10301-PA 1..179 6..184 951 97.8 Plus
Dsec\GM10203-PA 178 GM10203-PA 11..178 8..184 533 59.8 Plus
Dsec\GM10206-PA 195 GM10206-PA 3..195 4..184 297 38.5 Plus
Dsec\GM10294-PA 205 GM10294-PA 3..134 3..129 291 47 Plus
Dsec\GM10299-PA 186 GM10299-PA 8..186 10..184 277 41.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\E(spl)-PA 179 GD21264-PA 1..179 6..184 954 98.3 Plus
Dsim\HLHm5-PA 178 GD18153-PA 11..178 8..184 538 60.3 Plus
Dsim\HLHmbeta-PA 195 GD18157-PA 1..195 2..184 295 38.4 Plus
Dsim\HLHmgamma-PA 205 GD21258-PA 3..134 3..129 291 47 Plus
Dsim\HLHm7-PA 186 GD21263-PA 8..186 10..184 274 41.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23910-PA 182 GJ23910-PA 1..182 6..184 684 75.1 Plus
Dvir\GJ23319-PA 184 GJ23319-PA 9..184 8..184 507 56.4 Plus
Dvir\GJ23909-PA 197 GJ23909-PA 8..197 10..184 282 39.8 Plus
Dvir\GJ23323-PA 209 GJ23323-PA 3..209 4..184 280 38.5 Plus
Dvir\GJ23903-PA 217 GJ23903-PA 3..135 3..129 278 45.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14460-PA 191 GK14460-PA 1..191 6..184 682 73.4 Plus
Dwil\GK12804-PA 183 GK12804-PA 8..183 5..184 502 56.3 Plus
Dwil\GK14459-PA 200 GK14459-PA 8..200 10..184 301 39.4 Plus
Dwil\GK14455-PA 209 GK14455-PA 3..209 3..184 290 37 Plus
Dwil\GK12809-PA 201 GK12809-PA 1..201 2..184 243 35.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23650-PA 179 GE23650-PA 1..179 6..184 948 97.8 Plus
Dyak\GE10648-PA 179 GE10648-PA 12..179 8..184 538 60.3 Plus
Dyak\HLHmbeta-PA 195 GE10652-PA 1..195 2..184 297 38.1 Plus
Dyak\HLHmgamma-PA 205 GE23644-PA 3..166 3..160 293 41.9 Plus
Dyak\HLHm7-PA 186 GE23649-PA 8..186 10..184 277 41.1 Plus

RT01041.hyp Sequence

Translation from 17 to 556

> RT01041.hyp
MEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMD
KAEMLESAVIFMRQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMAS
TPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSMDKAPL
SPASSGYHSDCDSPAPSPQPMQQPLWRPW*

RT01041.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)m8-HLH-PA 179 CG8365-PA 1..179 1..179 933 100 Plus
E(spl)m5-HLH-PA 178 CG6096-PA 11..178 3..179 521 60.9 Plus
E(spl)m7-HLH-PA 186 CG8361-PA 8..186 5..179 306 40.7 Plus
E(spl)mbeta-HLH-PA 195 CG14548-PA 8..195 5..179 291 38.1 Plus
E(spl)mgamma-HLH-PA 205 CG8333-PA 6..205 1..179 288 35 Plus