Clone RT01055 Report

Search the DGRC for RT01055

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:10
Well:55
Vector:pCR2.1
Associated Gene/TranscriptCG15696-RA
Protein status:RT01055.pep: wuzgold
Sequenced Size:539

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15696 2006-05-19 RT target
CG15696 2008-04-29 Release 5.5 accounting
CG15696 2008-08-15 Release 5.9 accounting
CG15696 2008-12-18 5.12 accounting

Clone Sequence Records

RT01055.complete Sequence

539 bp (540 high quality bases) assembled on 2011-07-27

GenBank Submission: BT029150.2

> RT01055.complete
ATGAGTGACTTCAGCATCGAGTATATTTTGAACCGAGCCGGCGACAGATA
CGTGGGCACCAATGCCTCCTTGGGCGTCCTGCAGCGACTCCGTGCCAGCT
TGCCTTTCCATCCGTACGCCCACCCAGCATCTTATGTCTCAAAGGAGTCT
GGAGGATCTCCTCCAGCCTCGGCTGCGGAGGCTCAGATACCCGTCTACGA
TTGGCTGCAGTACACCCGGTACCATCCGCCCAAGTTGCCCAGAGCCCTCC
GCCAAAATGCGCCCGCCAAAAGGACTCCTGGTCGCCTGCCCCGCATCCCA
TTTACTCCGCAGCAGCTGCAGGCCCTGGAAAATGCCTACAAGGAGTCCAA
CTATCTGAGCGCCGAGGACGCCAACAAACTAGCCGACTCCTTGGAGCTGA
CCAATACGCGAGTGAAGATCTGGTTCCAGAATCGTAGGGCTCGCGAGCGA
CGGGAGAAGCGCGAAAAGGACGAGAGTTGCGACTCCACCTTCTCATCGAA
CGCCTCCAGTCCGGAACCGGAAATGATCGTTGTAACGTA

RT01055.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15696-RA 540 CG15696-RA 1..538 1..538 2630 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16670990..16671527 1..538 2630 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:40:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20847111..20847648 1..538 2630 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20587942..20588479 1..538 2630 99.2 Plus
Blast to na_te.dros performed on 2019-03-15 10:50:47 has no hits.

RT01055.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:45 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16670990..16671527 1..538 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:55:09 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
CG15696-RA 1..538 1..538 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:30 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
CG15696-RA 1..538 1..539 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:39 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
CG15696-RA 1..538 1..539 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:46:41 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
CG15696-RA 1..538 1..538 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:24 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
CG15696-RA 1..538 1..539 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:23:55 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
CG15696-RA 1..538 1..538 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:30 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
CG15696-RA 1..538 1..538 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:39 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
CG15696-RA 44..581 1..538 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:46:41 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
CG15696-RA 1..538 1..538 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:24 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
CG15696-RA 44..581 1..538 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:45 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20847111..20847648 1..538 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:45 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20847111..20847648 1..538 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:45 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20847111..20847648 1..538 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:39 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16672833..16673370 1..538 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:37 Download gff for RT01055.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20587942..20588479 1..538 99   Plus

RT01055.pep Sequence

Translation from 0 to 537

> RT01055.pep
MSDFSIEYILNRAGDRYVGTNASLGVLQRLRASLPFHPYAHPASYVSKES
GGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQNAPAKRTPGRLPRIP
FTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARER
REKREKDESCDSTFSSNASSPEPEMIVVT

RT01055.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17994-PA 178 GF17994-PA 1..178 1..179 695 82.7 Plus
Dana\GF23351-PA 530 GF23351-PA 423..493 76..151 176 48.7 Plus
Dana\GF18902-PA 526 GF18902-PA 252..372 37..162 163 34.4 Plus
Dana\GF16103-PA 489 GF16103-PA 355..453 65..165 159 37.9 Plus
Dana\GF23802-PA 532 GF23802-PA 451..515 95..159 151 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24188-PA 179 GG24188-PA 1..179 1..179 918 97.2 Plus
Dere\GG11670-PA 520 GG11670-PA 413..483 76..151 176 48.7 Plus
Dere\GG19873-PA 503 GG19873-PA 369..470 65..167 158 33.3 Plus
Dere\GG17017-PA 523 GG17017-PA 275..371 64..162 156 36.6 Plus
Dere\GG14457-PA 524 GG14457-PA 442..506 95..159 149 46.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15916-PA 173 GH15916-PA 1..173 1..179 632 78.5 Plus
Dgri\GH18901-PA 545 GH18901-PA 438..515 76..158 176 45.8 Plus
Dgri\GH17404-PA 540 GH17404-PA 323..393 91..162 160 41.7 Plus
Dgri\GH14408-PA 506 GH14408-PA 371..468 64..162 157 35.6 Plus
Dgri\GH14983-PA 559 GH14983-PA 469..533 95..159 150 46.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15696-PA 179 CG15696-PA 1..179 1..179 932 100 Plus
Dr-PA 515 CG1897-PA 408..478 76..151 178 48.7 Plus
E5-PA 524 CG9930-PA 251..379 37..170 161 33.1 Plus
ems-PA 494 CG2988-PA 349..452 54..158 158 33.6 Plus
exex-PA 525 CG8254-PA 440..504 95..159 149 46.2 Plus
scro-PF 307 CG17594-PF 93..169 95..171 148 41.6 Plus
scro-PA 468 CG17594-PA 254..330 95..171 148 41.6 Plus
Dll-PB 322 CG3629-PB 52..204 39..173 145 30.3 Plus
Dll-PA 327 CG3629-PA 52..204 39..173 145 30.3 Plus
Dll-PC 347 CG3629-PC 52..204 39..173 145 30.3 Plus
Drgx-PF 587 CG34340-PF 49..141 91..172 145 38.7 Plus
Drgx-PE 587 CG34340-PE 49..141 91..172 145 38.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10602-PA 178 GI10602-PA 1..175 1..178 652 80.9 Plus
Dmoj\GI23117-PA 537 GI23117-PA 430..500 76..151 177 48.7 Plus
Dmoj\GI22735-PA 541 GI22735-PA 292..388 64..162 159 37.6 Plus
Dmoj\GI10044-PA 514 GI10044-PA 377..470 64..158 153 36.1 Plus
Dmoj\GI13145-PA 551 GI13145-PA 463..527 95..159 150 46.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24283-PA 178 GL24283-PA 1..178 1..179 743 82.9 Plus
Dper\GL24224-PA 491 GL24224-PA 357..458 65..167 162 34.3 Plus
Dper\GL23326-PA 537 GL23326-PA 275..389 41..162 157 34.7 Plus
Dper\GL18045-PA 593 GL18045-PA 490..556 95..161 145 46.3 Plus
Dper\GL19887-PA 633 GL19887-PA 373..430 95..152 144 44.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13896-PA 178 GA13896-PA 1..178 1..179 743 82.9 Plus
Dpse\GA15116-PA 533 GA15116-PA 426..496 76..151 177 48.7 Plus
Dpse\GA15560-PA 493 GA15560-PA 359..460 65..167 162 34.3 Plus
Dpse\GA30153-PA 512 GA30153-PA 296..366 91..162 154 40.3 Plus
Dpse\GA20934-PA 575 GA20934-PA 486..550 95..159 150 46.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23140-PA 179 GM23140-PA 1..179 1..179 923 97.8 Plus
Dsec\GM12794-PA 533 GM12794-PA 395..471 76..157 177 46.3 Plus
Dsec\GM25901-PA 523 GM25901-PA 275..371 64..162 157 36.6 Plus
Dsec\GM24141-PA 513 GM24141-PA 379..480 65..167 156 33.3 Plus
Dsec\GM25007-PA 523 GM25007-PA 440..504 95..159 150 46.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19379-PA 198 GD19379-PA 1..158 1..158 715 87.3 Plus
Dsim\GD21441-PA 514 GD21441-PA 407..477 76..151 176 48.7 Plus
Dsim\GD18937-PA 496 GD18937-PA 362..463 65..167 158 33.3 Plus
Dsim\GD20470-PA 526 GD20470-PA 276..372 64..162 157 36.6 Plus
Dsim\GD14043-PA 321 GD14043-PA 237..301 95..159 148 46.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22956-PA 180 GJ22956-PA 1..171 1..174 630 81.7 Plus
Dvir\GJ10606-PA 505 GJ10606-PA 398..468 76..151 177 48.7 Plus
Dvir\GJ24670-PA 537 GJ24670-PA 282..378 64..162 159 37.6 Plus
Dvir\GJ22569-PA 496 GJ22569-PA 361..463 64..167 157 34.9 Plus
Dvir\GJ13893-PA 557 GJ13893-PA 470..534 95..159 150 46.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22474-PA 195 GK22474-PA 1..195 1..179 609 72.8 Plus
Dwil\GK11900-PA 515 GK11900-PA 408..478 76..151 177 48.7 Plus
Dwil\GK22678-PA 476 GK22678-PA 342..440 64..163 163 36.3 Plus
Dwil\GK22485-PA 472 GK22485-PA 289..385 64..162 155 36.6 Plus
Dwil\GK20585-PA 578 GK20585-PA 487..551 95..159 149 46.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25692-PA 179 GE25692-PA 1..179 1..179 916 96.6 Plus
Dyak\GE23858-PA 517 GE23858-PA 410..480 76..151 176 48.7 Plus
Dyak\GE26304-PA 499 GE26304-PA 365..466 65..167 158 33.3 Plus
Dyak\GE24407-PA 527 GE24407-PA 275..371 64..162 157 36.6 Plus
Dyak\GE21647-PA 532 GE21647-PA 448..512 95..159 150 46.2 Plus

RT01055.hyp Sequence

Translation from 1 to 537

> RT01055.hyp
MSDFSIEYILNRAGDRYVGTNASLGVLQRLRASLPFHPYAHPASYVSKES
GGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQNAPAKRTPGRLPRIP
FTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARER
REKREKDESCDSTFSSNASSPEPEMIVVT

RT01055.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15696-PA 179 CG15696-PA 1..179 1..179 932 100 Plus
Dr-PA 515 CG1897-PA 408..478 76..151 178 48.7 Plus
E5-PA 524 CG9930-PA 251..379 37..170 161 33.1 Plus
ems-PA 494 CG2988-PA 349..452 54..158 158 33.6 Plus
scro-PF 307 CG17594-PF 93..169 95..171 148 41.6 Plus