Clone RT01061 Report

Search the DGRC for RT01061

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:10
Well:61
Vector:pCR2.1
Associated Gene/Transcriptcato-RA
Protein status:RT01061.pep: gold
Sequenced Size:570

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7760 2006-05-19 RT target
cato 2008-04-29 Release 5.5 accounting
cato 2008-08-15 Release 5.9 accounting
cato 2008-12-18 5.12 accounting

Clone Sequence Records

RT01061.complete Sequence

570 bp (570 high quality bases) assembled on 2008-07-29

GenBank Submission: BT028836

> RT01061.complete
ATGAGCTACTACTACTCGTCTGCCTCCGAGGAGGATGGCAGTTCCCAGTA
CCTGGGCAGTCCCAACTACAACTTGACCCAGTTGCCGCCAGTTTCTGGCC
AGGATTACGGACAGGGGGCTTTCTTATCGCCGGAATGGCAATTCTTGGAT
GCCGCAGGCGGAACTCAAACGGAACTAGGACCCATCATGGAGGCGCAAGG
ACAGCACACCCAGCCGCAGACCAAACGGCGGAGTAACAGCTTCACAGGAT
CGGACGGTAGGAAGAGCAGTCCAGAGCAGACCAATCTCAGTCCCACGGTC
CAGAAAAGGAGACGACAGGCTGCCAATGCGCGGGAAAGGAAGCGGATGAA
TGGATTGAATGCGGCTTTCGAGCGCCTAAGGGAAGTGGTGCCCGCTCCGT
CCATTGACCAGAAATTGTCCAAGTTCGAGACTCTCCAGATGGCCCAGTCC
TACATCCTGGCGCTGTGCGATCTTCTCAACAACGGGGACGTGGAAGTGGA
TGCCGCTGCATACACCATCTTCGGCGACAGCGATAGTGGATTTGGATTGA
GCGGAGGATCCTTGTCATAG

RT01061.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
cato-RA 579 cato-RA 1..570 1..570 2850 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12165142..12165711 570..1 2850 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:40:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16277789..16278358 570..1 2850 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16278988..16279557 570..1 2850 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:07:12 has no hits.

RT01061.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:08:06 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12165142..12165711 1..570 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:55:13 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
cato-RA 1..570 1..570 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:39 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
cato-RA 1..570 1..570 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:48 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
cato-RA 1..570 1..570 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:47:35 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
cato-RA 1..570 1..570 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:31:07 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
cato-RA 1..570 1..570 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:54 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
cato-RA 1..570 1..570 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:39 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
cato-RA 1..570 1..570 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:48 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
cato-RA 40..609 1..570 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:47:35 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
cato-RA 1..570 1..570 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:31:07 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
cato-RA 39..608 1..570 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:06 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16277789..16278358 1..570 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:06 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16277789..16278358 1..570 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:06 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16277789..16278358 1..570 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:48 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12165294..12165863 1..570 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:59 Download gff for RT01061.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16278988..16279557 1..570 100   Minus

RT01061.pep Sequence

Translation from 0 to 569

> RT01061.pep
MSYYYSSASEEDGSSQYLGSPNYNLTQLPPVSGQDYGQGAFLSPEWQFLD
AAGGTQTELGPIMEAQGQHTQPQTKRRSNSFTGSDGRKSSPEQTNLSPTV
QKRRRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQS
YILALCDLLNNGDVEVDAAAYTIFGDSDSGFGLSGGSLS*

RT01061.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11275-PA 200 GF11275-PA 1..200 1..189 656 70.1 Plus
Dana\GF18335-PA 310 GF18335-PA 238..309 86..159 209 58.1 Plus
Dana\GF14839-PA 199 GF14839-PA 136..195 100..159 195 63.3 Plus
Dana\GF14327-PA 407 GF14327-PA 158..213 104..159 152 48.2 Plus
Dana\GF16621-PA 195 GF16621-PA 10..144 21..160 148 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22282-PA 189 GG22282-PA 1..189 1..189 841 91.1 Plus
Dere\GG24254-PA 315 GG24254-PA 240..314 83..159 209 55.8 Plus
Dere\GG21703-PA 196 GG21703-PA 133..192 100..159 197 65 Plus
Dere\GG11475-PA 386 GG11475-PA 63..163 56..165 163 37.6 Plus
Dere\GG21298-PA 392 GG21298-PA 157..212 104..159 153 48.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19754-PA 189 GH19754-PA 1..187 1..183 539 61.3 Plus
Dgri\GH18671-PA 326 GH18671-PA 254..325 86..159 209 58.1 Plus
Dgri\GH10530-PA 214 GH10530-PA 151..211 100..160 199 63.9 Plus
Dgri\GH13314-PA 421 GH13314-PA 102..226 65..185 161 35.7 Plus
Dgri\GH16587-PA 400 GH16587-PA 144..233 72..164 152 38.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
cato-PA 189 CG7760-PA 1..189 1..189 972 100 Plus
ato-PA 312 CG7508-PA 237..311 83..159 200 55.8 Plus
amos-PA 198 CG10393-PA 102..195 68..160 199 50 Plus
tx-PB 384 CG5441-PB 63..163 56..165 152 37.6 Plus
tx-PA 384 CG5441-PA 63..163 56..165 152 37.6 Plus
dimm-PB 390 CG8667-PB 131..236 78..184 150 35.5 Plus
dimm-PA 390 CG8667-PA 131..236 78..184 150 35.5 Plus
Fer3-PA 195 CG6913-PA 50..143 66..160 144 36.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20292-PA 196 GI20292-PA 1..194 1..185 475 55.1 Plus
Dmoj\GI24182-PA 330 GI24182-PA 258..329 86..159 209 56.8 Plus
Dmoj\GI17198-PA 217 GI17198-PA 154..213 100..159 195 63.3 Plus
Dmoj\GI23534-PA 187 GI23534-PA 51..134 71..160 154 40 Plus
Dmoj\GI12220-PA 413 GI12220-PA 148..203 104..159 151 48.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23421-PA 327 GL23421-PA 253..326 84..159 210 56.6 Plus
Dper\GL11355-PA 126 GL11355-PA 1..122 1..115 209 48.4 Plus
Dper\GL18743-PA 206 GL18743-PA 140..202 97..159 200 63.5 Plus
Dper\GL26661-PA 421 GL26661-PA 152..231 104..184 158 43.2 Plus
Dper\GL15578-PA 412 GL15578-PA 130..223 72..167 152 39.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20568-PA 197 GA20568-PA 1..197 1..186 590 65.3 Plus
Dpse\ato-PA 330 GA20401-PA 256..329 84..159 210 56.6 Plus
Dpse\GA10296-PA 206 GA10296-PA 140..202 97..159 200 63.5 Plus
Dpse\GA21247-PA 421 GA21247-PA 152..231 104..184 158 43.2 Plus
Dpse\GA20508-PA 412 GA20508-PA 130..223 72..167 152 39.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20070-PA 188 GM20070-PA 1..188 1..189 955 97.4 Plus
Dsec\GM23715-PA 312 GM23715-PA 233..311 79..159 213 54.3 Plus
Dsec\GM17083-PA 197 GM17083-PA 134..193 100..159 197 65 Plus
Dsec\GM25695-PA 398 GM25695-PA 126..213 72..162 149 38.5 Plus
Dsec\GM10936-PA 247 GM10936-PA 83..137 105..159 142 49.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25551-PA 188 GD25551-PA 1..188 1..189 960 97.9 Plus
Dsim\GD18530-PA 284 GD18530-PA 220..283 96..159 206 60.9 Plus
Dsim\GD21828-PA 197 GD21828-PA 134..193 100..159 196 65 Plus
Dsim\GD21279-PA 386 GD21279-PA 63..163 56..165 163 37.6 Plus
Dsim\GD24318-PA 386 GD24318-PA 155..210 104..159 153 48.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22019-PA 197 GJ22019-PA 1..197 1..185 561 62.8 Plus
Dvir\ato-PA 325 GJ10529-PA 246..324 79..159 213 55.6 Plus
Dvir\GJ19805-PA 201 GJ19805-PA 130..197 92..159 208 58.8 Plus
Dvir\GJ17849-PA 418 GJ17849-PA 151..231 104..185 154 41.5 Plus
Dvir\GJ12331-PA 390 GJ12331-PA 140..229 72..164 153 39.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20722-PA 168 GK20722-PA 1..167 1..186 430 54.3 Plus
Dwil\GK11390-PA 331 GK11390-PA 267..330 96..159 209 62.5 Plus
Dwil\GK24655-PA 198 GK24655-PA 135..194 100..159 197 63.3 Plus
Dwil\GK21091-PA 351 GK21091-PA 239..311 82..155 158 48.6 Plus
Dwil\GK18738-PA 392 GK18738-PA 154..233 104..184 157 43.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14078-PA 189 GE14078-PA 1..189 1..189 862 93.2 Plus
Dyak\GE25860-PA 313 GE25860-PA 238..312 83..159 210 55.8 Plus
Dyak\GE12726-PA 198 GE12726-PA 135..194 100..159 196 65 Plus
Dyak\GE23667-PA 387 GE23667-PA 63..163 56..165 163 37.6 Plus
Dyak\GE12913-PA 393 GE12913-PA 157..212 104..159 153 48.2 Plus

RT01061.hyp Sequence

Translation from 1 to 569

> RT01061.hyp
MSYYYSSASEEDGSSQYLGSPNYNLTQLPPVSGQDYGQGAFLSPEWQFLD
AAGGTQTELGPIMEAQGQHTQPQTKRRSNSFTGSDGRKSSPEQTNLSPTV
QKRRRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQS
YILALCDLLNNGDVEVDAAAYTIFGDSDSGFGLSGGSLS*

RT01061.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
cato-PA 189 CG7760-PA 1..189 1..189 972 100 Plus
ato-PA 312 CG7508-PA 237..311 83..159 200 55.8 Plus
amos-PA 198 CG10393-PA 102..195 68..160 199 50 Plus
tx-PB 384 CG5441-PB 63..163 56..165 152 37.6 Plus
tx-PA 384 CG5441-PA 63..163 56..165 152 37.6 Plus