Clone RT01102 Report

Search the DGRC for RT01102

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:11
Well:2
Vector:pCR2.1
Associated Gene/TranscriptPHDP-RA
Protein status:RT01102.pep: gold
Sequenced Size:695

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11182 2006-05-19 RT target
PHDP 2008-04-29 Release 5.5 accounting
PHDP 2008-08-15 Release 5.9 accounting
PHDP 2008-12-18 5.12 accounting

Clone Sequence Records

RT01102.complete Sequence

695 bp (695 high quality bases) assembled on 2008-07-28

GenBank Submission: BT028839

> RT01102.complete
GAAGTTATCAGTCGACATGGAATTTTCACTGCTCAACAAGGCGAACTTCG
ACAAGGATTGTTTGTACACCGCGAACTCGGAGTTCTACAACAGCGGCGCC
AATGGAGGAGGACTCTCCGTGGCCAATCACATAAATCACTACAACCTCAT
GATTGACTCCAGTTACAAGCTCTGCGCCAACGAGTCCGCAATCCGGGGTT
CCCTCAACCAGGAGTCGAGCTTATTGTTCTCCAAAATCACCACTGTCTCC
GAGTTTTACCCGGCCACCCATAACATTGGCTCCTACAACACGGACTTCCA
TTTGAAGTCCTATGGAGACGACGGCTTGAGCCTGACCGACAAATCAAAAC
AGAGGCGCATTCGCACCACTTTCACGTCCAACCAGCTGAACGAGCTGGAG
AAGATCTTCCTGGAAACCCACTACCCAGATATCTACACCAGGGAAGAGAT
CGCATCCAAGCTGCACTTGACGGAAGCTCGAGTTCAGGTCTGGTTCCAGA
ACAGAAGAGCCAAGTTTCGCAAGCAGGAGAGGCATGCCATTTACATAATG
AAGGACAAGTCGAGCAAATTGGATGGCCGGAAGAATCCTGTAGCAGGATC
GAAATACCTGGGCCCATCTCTCAAGGGACCCCAGAATGGCCATGGCCGTC
AAATGAAATGCTTATACGATCAAATATAGAAGCTTTATCGACCAT

RT01102.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
PHDP-RA 1040 PHDP-RA 227..891 17..681 3325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19770079..19770355 293..17 1385 100 Minus
chr2R 21145070 chr2R 19769788..19769984 489..293 985 100 Minus
chr2R 21145070 chr2R 19769328..19769523 681..486 980 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:40:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23884036..23884312 293..17 1385 100 Minus
2R 25286936 2R 23883745..23883941 489..293 985 100 Minus
2R 25286936 2R 23883285..23883480 681..486 980 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23885235..23885511 293..17 1385 100 Minus
2R 25260384 2R 23884944..23885140 489..293 985 100 Minus
2R 25260384 2R 23884484..23884679 681..486 980 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:46:13 has no hits.

RT01102.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:47:12 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19770079..19770357 13..293 99   Minus
chr2R 19769790..19769983 294..487 100 <- Minus
chr2R 19769328..19769521 488..681 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:55:17 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
PHDP-RA 1..663 17..679 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:52 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
PHDP-RA 1..663 17..679 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:30:20 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
PHDP-RA 1..663 17..679 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:46:50 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
PHDP-RA 1..663 17..679 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:00:00 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
PHDP-RA 1..663 17..679 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:23:58 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
PHDP-RA 1..665 17..681 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:52 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
PHDP-RA 1..665 17..681 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:30:20 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
PHDP-RA 127..793 13..681 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:46:50 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
PHDP-RA 1..665 17..681 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:00:00 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
PHDP-RA 127..793 13..681 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:12 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23883285..23883478 488..681 100 <- Minus
2R 23883747..23883940 294..487 100 <- Minus
2R 23884036..23884314 13..293 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:12 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23883285..23883478 488..681 100 <- Minus
2R 23883747..23883940 294..487 100 <- Minus
2R 23884036..23884314 13..293 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:12 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23883285..23883478 488..681 100 <- Minus
2R 23883747..23883940 294..487 100 <- Minus
2R 23884036..23884314 13..293 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:30:20 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19770808..19771001 488..681 100 <- Minus
arm_2R 19771270..19771463 294..487 100 <- Minus
arm_2R 19771559..19771837 13..293 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:03 Download gff for RT01102.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23885253..23885531 13..293 99   Minus
2R 23884964..23885157 294..487 100 <- Minus
2R 23884502..23884695 488..681 100 <- Minus

RT01102.pep Sequence

Translation from 1 to 678

> RT01102.pep
KLSVDMEFSLLNKANFDKDCLYTANSEFYNSGANGGGLSVANHINHYNLM
IDSSYKLCANESAIRGSLNQESSLLFSKITTVSEFYPATHNIGSYNTDFH
LKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEI
ASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVAGS
KYLGPSLKGPQNGHGRQMKCLYDQI*

RT01102.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12058-PA 217 GF12058-PA 1..217 6..225 1041 89.1 Plus
Dana\GF20646-PA 405 GF20646-PA 77..142 112..177 268 72.7 Plus
Dana\GF15246-PA 589 GF15246-PA 19..119 78..189 261 49.1 Plus
Dana\GF13323-PA 279 GF13323-PA 113..181 109..177 252 65.2 Plus
Dana\GF15026-PA 325 GF15026-PA 2..65 114..177 248 68.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19984-PA 219 GG19984-PA 1..219 6..225 1125 94.5 Plus
Dere\GG24714-PA 416 GG24714-PA 86..151 112..177 268 72.7 Plus
Dere\GG20068-PA 281 GG20068-PA 118..179 116..177 253 71 Plus
Dere\GG24732-PA 352 GG24732-PA 2..65 114..177 250 68.8 Plus
Dere\GG23943-PA 419 GG23943-PA 190..280 115..203 249 51.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20193-PA 219 GH20193-PA 1..219 6..225 829 70.6 Plus
Dgri\GH11220-PA 376 GH11220-PA 52..130 92..177 273 60.5 Plus
Dgri\GH23067-PA 285 GH23067-PA 136..197 116..177 253 71 Plus
Dgri\GH11036-PA 372 GH11036-PA 2..75 114..187 252 63.5 Plus
Dgri\GH11236-PA 372 GH11236-PA 2..75 114..187 252 63.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
PHDP-PA 220 CG11182-PA 1..220 6..225 1156 100 Plus
al-PA 408 CG3935-PA 82..145 114..177 255 75 Plus
Drgx-PF 587 CG34340-PF 19..119 78..189 250 49.1 Plus
Drgx-PE 587 CG34340-PE 19..119 78..189 250 49.1 Plus
otp-PJ 374 CG10036-PJ 47..176 32..177 241 39.7 Plus
otp-PK 416 CG10036-PK 47..176 32..177 241 39.7 Plus
Pph13-PA 357 CG2819-PA 5..70 112..177 237 68.2 Plus
CG9876-PA 275 CG9876-PA 116..177 116..177 236 71 Plus
otp-PC 271 CG10036-PC 9..73 113..177 233 66.2 Plus
otp-PF 313 CG10036-PF 9..73 113..177 233 66.2 Plus
Ptx1-PA 509 CG1447-PA 194..327 39..180 233 42.4 Plus
Ptx1-PC 514 CG1447-PC 199..332 39..180 233 42.4 Plus
prd-PA 590 CG6716-PA 165..248 90..175 233 54.7 Plus
Ptx1-PE 610 CG1447-PE 194..327 39..180 233 42.4 Plus
prd-PB 613 CG6716-PB 188..271 90..175 233 54.7 Plus
Rx-PB 904 CG10052-PB 489..619 27..177 233 41.4 Plus
CG34367-PB 297 CG34367-PB 67..157 115..203 230 51.6 Plus
CG34367-PC 420 CG34367-PC 190..280 115..203 230 51.6 Plus
CG11294-PB 261 CG11294-PB 21..84 114..177 229 65.6 Plus
CG11294-PA 261 CG11294-PA 21..84 114..177 229 65.6 Plus
hbn-PA 409 CG33152-PA 129..223 96..190 227 48 Plus
gsb-PA 427 CG3388-PA 170..243 102..175 222 59.5 Plus
otp-PI 367 CG10036-PI 47..169 32..177 221 38.4 Plus
otp-PE 409 CG10036-PE 47..169 32..177 221 38.4 Plus
CG32532-PB 354 CG32532-PB 180..240 117..177 217 67.2 Plus
CG32532-PC 358 CG32532-PC 180..240 117..177 217 67.2 Plus
CG32532-PD 688 CG32532-PD 510..570 117..177 217 67.2 Plus
otp-PG 264 CG10036-PG 6..66 117..177 216 65.6 Plus
otp-PH 306 CG10036-PH 6..66 117..177 216 65.6 Plus
OdsH-PA 382 CG6352-PA 153..217 112..176 215 63.1 Plus
gsb-n-PA 449 CG2692-PA 179..239 114..174 212 65.6 Plus
ey-PB 624 CG1464-PB 186..257 106..177 211 54.2 Plus
ey-PA 838 CG1464-PA 400..471 106..177 211 54.2 Plus
ey-PC 857 CG1464-PC 419..490 106..177 211 54.2 Plus
ey-PD 898 CG1464-PD 460..531 106..177 211 54.2 Plus
oc-PD 542 CG12154-PD 40..144 91..199 210 43.6 Plus
oc-PG 542 CG12154-PG 40..144 91..199 210 43.6 Plus
oc-PC 542 CG12154-PC 40..144 91..199 210 43.6 Plus
toy-PA 543 CG11186-PA 178..325 31..177 207 31.8 Plus
Vsx2-PA 640 CG33980-PA 208..290 98..177 207 51.8 Plus
Vsx2-PB 645 CG33980-PB 208..290 98..177 207 51.8 Plus
repo-PA 612 CG31240-PA 303..363 116..176 206 62.3 Plus
oc-PE 539 CG12154-PE 63..141 116..199 205 52.4 Plus
oc-PF 548 CG12154-PF 72..150 116..199 205 52.4 Plus
toe-PA 640 CG10704-PA 371..455 105..188 203 50.6 Plus
unc-4-PC 588 CG6269-PC 225..302 96..176 201 54.3 Plus
unc-4-PB 588 CG6269-PB 225..302 96..176 201 54.3 Plus
Vsx1-PB 837 CG4136-PB 383..455 105..177 200 54.8 Plus
Vsx1-PA 837 CG4136-PA 383..455 105..177 200 54.8 Plus
eyg-PC 670 CG10488-PC 338..408 107..177 198 56.3 Plus
eyg-PB 670 CG10488-PB 338..408 107..177 198 56.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20720-PA 216 GI20720-PA 1..216 6..225 794 68.6 Plus
Dmoj\GI21624-PA 397 GI21624-PA 68..132 113..177 271 73.8 Plus
Dmoj\GI23866-PA 623 GI23866-PA 36..136 78..189 262 49.1 Plus
Dmoj\GI21136-PA 277 GI21136-PA 124..185 116..177 251 71 Plus
Dmoj\GI21809-PA 392 GI21809-PA 2..79 114..191 251 60.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10922-PA 216 GL10922-PA 1..216 6..225 1022 86.4 Plus
Dper\GL18872-PA 397 GL18872-PA 78..143 112..177 269 72.7 Plus
Dper\GL18665-PA 370 GL18665-PA 19..119 78..189 258 49.1 Plus
Dper\GL11298-PA 269 GL11298-PA 105..173 109..177 255 66.7 Plus
Dper\GL18888-PA 376 GL18888-PA 2..65 114..177 251 68.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:12:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10822-PA 216 GA10822-PA 1..216 6..225 1022 86.4 Plus
Dpse\GA17785-PA 395 GA17785-PA 78..143 112..177 269 72.7 Plus
Dpse\GA22090-PA 269 GA22090-PA 105..173 109..177 255 66.7 Plus
Dpse\GA15474-PA 376 GA15474-PA 2..65 114..177 251 68.8 Plus
Dpse\GA19807-PA 646 GA19807-PA 208..275 106..175 246 62.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:12:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15498-PA 220 GM15498-PA 1..220 6..225 1163 98.2 Plus
Dsec\GM16736-PA 410 GM16736-PA 80..145 112..177 270 72.7 Plus
Dsec\GM16755-PA 348 GM16755-PA 2..65 114..177 251 68.8 Plus
Dsec\GM15584-PA 273 GM15584-PA 116..177 116..177 250 71 Plus
Dsec\GM26340-PA 613 GM26340-PA 204..271 106..175 250 62.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25001-PA 220 GD25001-PA 1..220 6..225 1174 98.6 Plus
Dsim\GD23020-PA 410 GD23020-PA 80..145 112..177 270 72.7 Plus
Dsim\GD23036-PA 355 GD23036-PA 5..70 112..177 252 68.2 Plus
Dsim\GD25082-PA 275 GD25082-PA 116..177 116..177 250 71 Plus
Dsim\GD22133-PA 613 GD22133-PA 204..271 106..175 249 62.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20457-PA 216 GJ20457-PA 1..216 6..225 756 64.5 Plus
Dvir\GJ17771-PA 381 GJ17771-PA 67..132 112..177 271 72.7 Plus
Dvir\GJ20984-PA 288 GJ20984-PA 112..194 89..177 258 56.2 Plus
Dvir\GJ17788-PA 378 GJ17788-PA 2..65 114..177 252 68.8 Plus
Dvir\GJ17468-PA 881 GJ17468-PA 540..603 114..177 245 65.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15860-PA 692 GK15860-PA 543..692 77..225 567 73.7 Plus
Dwil\GK15860-PA 692 GK15860-PA 1..94 6..99 374 69.1 Plus
Dwil\GK23788-PA 375 GK23788-PA 65..129 113..177 272 73.8 Plus
Dwil\GK19597-PA 288 GK19597-PA 105..173 109..177 255 66.7 Plus
Dwil\GK21081-PA 614 GK21081-PA 201..296 106..203 252 49 Plus
Dwil\GK24418-PA 364 GK24418-PA 2..65 114..177 248 68.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11517-PA 219 GE11517-PA 1..219 6..225 1136 95.9 Plus
Dyak\GE16769-PA 410 GE16769-PA 80..145 112..177 270 72.7 Plus
Dyak\GE11607-PA 286 GE11607-PA 126..187 116..177 253 71 Plus
Dyak\GE16946-PA 353 GE16946-PA 2..65 114..177 249 68.8 Plus
Dyak\GE26064-PA 420 GE26064-PA 190..281 115..204 248 51.1 Plus

RT01102.hyp Sequence

Translation from 16 to 678

> RT01102.hyp
MEFSLLNKANFDKDCLYTANSEFYNSGANGGGLSVANHINHYNLMIDSSY
KLCANESAIRGSLNQESSLLFSKITTVSEFYPATHNIGSYNTDFHLKSYG
DDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLH
LTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVAGSKYLGP
SLKGPQNGHGRQMKCLYDQI*

RT01102.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
PHDP-PA 220 CG11182-PA 1..220 1..220 1156 100 Plus
al-PA 408 CG3935-PA 82..145 109..172 255 75 Plus
CG34340-PF 587 CG34340-PF 19..119 73..184 250 49.1 Plus
CG34340-PE 587 CG34340-PE 19..119 73..184 250 49.1 Plus
otp-PJ 374 CG10036-PJ 47..176 27..172 241 39.7 Plus