Clone RT01106 Report

Search the DGRC for RT01106

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:11
Well:6
Vector:pCR2.1
Associated Gene/TranscriptCG4676-RA
Protein status:RT01106.pep: gold
Sequenced Size:885

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4676 2006-05-19 RT target
CG4676 2008-04-29 Release 5.5 accounting
CG4676 2008-08-15 Release 5.9 accounting
CG4676 2008-12-18 5.12 accounting

Clone Sequence Records

RT01106.complete Sequence

885 bp (885 high quality bases) assembled on 2008-07-29

GenBank Submission: BT028843

> RT01106.complete
AGTTATCAGTCGACATGATGATTTTGCGCTCGTGGGATCGCGTTAAACCT
CGTTCCATTTCGGATTTCGCATGTTTCCTCCTGGTGGCTGTCTTTGTGCC
CGTGACATACATCTTCCATGTGACCATTGTTATGCCGGAACTGTTTGCCA
TCGGAGGGATTTGGTACACGTTATTATGGTTGGCCAGCCTGTTCCTCATC
TTCAACATCACATCCAACATGCTGGCCTGCATGCTTGTGGACACTAGTAT
CCGCAAGGAGCTGCTGAAGCCACCGTTGGATGCGGCGCAGCTGGCACGGT
GGCACTCTTGCCAGGATTGTCAGACATTGGTGCCACCTCGATCCTGGCAC
TGCGAAGTGTGCAACGTGTGCGTGCTGAAGCGGGACCACCACTGTCGGTT
CACTTGCTGCTGCATCGGGCATCACAACTACAGGTACTTCTTCTACTACC
TGGTTTACATGATCATCGGATCCTTGGCGGCCGCCATCATGGAGAGCATC
TATCTGTGGCATCTCCATCTGGACATCTACTGGCGCTGGTCTACGCTGTT
CACCATATTTGCTCCCGTGGTTAGCCTGATGCTGTCTCCAAGCTGGGAGT
CCTTCTACTTGGTCATATATGATCTCACCCTTCTGGGCTTCGCCATATCA
TCCTTGCTCCTTGTCTTCCACTGGTCGATATTCAAGAGCGGTTCGGTGAC
ACGAGAGCGCGGCACAAGAAAGTACGATCGCGGTTTGCGGGGTAACCTGG
AGATGGTTCTGGGCAAGAGAATGCATCTCACCTGGCTGTCGCCGTTTCTA
CGCAGCGATCTGCCACACGACGGAATGAACTGGGAACCCATAGCCGCCTT
TTCTCCAAAGGAGGAATAGAAGCTTTATCGACCAT

RT01106.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG4676-RA 1254 CG4676-RA 153..1009 14..870 4285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9123664..9124278 256..870 3075 100 Plus
chr2R 21145070 chr2R 9123370..9123611 14..255 1210 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:40:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13236308..13236922 256..870 3075 100 Plus
2R 25286936 2R 13236014..13236255 14..255 1210 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13237507..13238121 256..870 3075 100 Plus
2R 25260384 2R 13237213..13237454 14..255 1210 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:54:42 has no hits.

RT01106.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:55:34 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9123370..9123611 14..255 100 -> Plus
chr2R 9123664..9124285 256..878 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:55:21 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
CG4676-RA 1..855 15..869 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:10 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
CG4676-RA 1..855 15..869 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:24:25 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
CG4676-RA 1..855 15..869 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:48:06 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
CG4676-RA 1..855 15..869 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:01 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
CG4676-RA 1..855 15..869 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:04 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
CG4676-RA 153..1008 14..869 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:10 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
CG4676-RA 153..1016 14..878 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:24:25 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
CG4676-RA 35..898 14..878 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:48:06 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
CG4676-RA 153..1008 14..869 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:01 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
CG4676-RA 35..898 14..878 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:55:34 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13236014..13236255 14..255 100 -> Plus
2R 13236308..13236929 256..878 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:55:34 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13236014..13236255 14..255 100 -> Plus
2R 13236308..13236929 256..878 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:55:34 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13236014..13236255 14..255 100 -> Plus
2R 13236308..13236929 256..878 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:24:25 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9123519..9123760 14..255 100 -> Plus
arm_2R 9123813..9124434 256..878 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:39 Download gff for RT01106.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13237213..13237454 14..255 100 -> Plus
2R 13237507..13238128 256..878 99   Plus

RT01106.pep Sequence

Translation from 2 to 868

> RT01106.pep
LSVDMMILRSWDRVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAI
GGIWYTLLWLASLFLIFNITSNMLACMLVDTSIRKELLKPPLDAAQLARW
HSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYL
VYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWES
FYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLRGNLE
MVLGKRMHLTWLSPFLRSDLPHDGMNWEPIAAFSPKEE*

RT01106.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13682-PA 283 GF13682-PA 1..283 6..288 1160 73.9 Plus
Dana\GF13019-PA 280 GF13019-PA 9..280 16..287 688 45.1 Plus
Dana\GF14793-PA 329 GF14793-PA 1..260 6..278 459 38.5 Plus
Dana\GF19937-PA 305 GF19937-PA 14..289 20..286 432 34.8 Plus
Dana\GF23939-PA 259 GF23939-PA 4..247 43..278 396 36.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20369-PA 283 GG20369-PA 1..283 6..288 1443 95.1 Plus
Dere\GG20694-PA 278 GG20694-PA 9..271 16..278 667 44.7 Plus
Dere\GG13586-PA 288 GG13586-PA 46..280 43..278 427 38.5 Plus
Dere\GG12221-PA 281 GG12221-PA 26..272 27..278 403 37.4 Plus
Dere\GG12220-PA 278 GG12220-PA 26..278 27..283 372 33.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21619-PA 280 GH21619-PA 1..280 6..288 988 67.6 Plus
Dgri\GH20531-PA 286 GH20531-PA 9..272 16..278 650 43.2 Plus
Dgri\GH20532-PA 279 GH20532-PA 9..274 17..281 500 36.3 Plus
Dgri\GH25236-PA 308 GH25236-PA 44..297 36..278 372 35.5 Plus
Dgri\GH23419-PA 308 GH23419-PA 44..297 36..278 366 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG4676-PA 284 CG4676-PA 1..284 5..288 1552 100 Plus
CG10344-PB 278 CG10344-PB 9..270 16..277 696 44.9 Plus
CG10344-PA 198 CG10344-PA 9..191 16..198 496 44.1 Plus
CG18810-PA 300 CG18810-PA 1..283 6..279 446 35.2 Plus
CG13029-PC 288 CG13029-PC 31..280 30..278 425 37.8 Plus
CG17197-PB 290 CG17197-PB 29..272 30..278 425 36.7 Plus
CG4956-PA 302 CG4956-PA 34..296 13..277 420 31.6 Plus
CG17196-PA 276 CG17196-PA 26..271 27..278 397 33.3 Plus
CG17196-PC 253 CG17196-PC 30..248 52..278 388 34.5 Plus
CG17196-PB 251 CG17196-PB 36..246 60..278 380 34.8 Plus
CG17195-PA 283 CG17195-PA 28..278 27..278 372 30.7 Plus
CG17198-PB 299 CG17198-PB 32..294 8..278 366 31.6 Plus
CG17198-PA 299 CG17198-PA 32..294 8..278 366 31.6 Plus
CG5880-PA 381 CG5880-PA 65..232 25..195 182 27.1 Plus
Dnz1-PA 276 CG6627-PA 91..256 90..264 178 24.1 Plus
CG34449-PC 500 CG34449-PC 40..223 45..244 177 27.7 Plus
CG34449-PD 523 CG34449-PD 40..223 45..244 177 27.7 Plus
CG34449-PF 852 CG34449-PF 40..223 45..244 177 27.7 Plus
CG34449-PG 906 CG34449-PG 10..218 31..244 177 25.7 Plus
CG34449-PB 911 CG34449-PB 40..223 45..244 177 27.7 Plus
CG34449-PA 934 CG34449-PA 40..223 45..244 177 27.7 Plus
CG34449-PE 1052 CG34449-PE 40..223 45..244 177 27.7 Plus
CG5196-PB 395 CG5196-PB 50..127 89..169 167 39.5 Plus
CG5196-PA 427 CG5196-PA 82..159 89..169 167 39.5 Plus
CG1407-PE 440 CG1407-PE 131..246 103..211 167 31.9 Plus
CG1407-PB 338 CG1407-PB 131..249 103..211 164 31.1 Plus
CG1407-PD 352 CG1407-PD 131..249 103..211 164 31.1 Plus
CG1407-PA 443 CG1407-PA 131..249 103..211 164 31.1 Plus
CG1407-PC 227 CG1407-PC 131..189 103..161 160 42.4 Plus
CG1407-PF 449 CG1407-PF 131..189 103..161 160 42.4 Plus
CG1407-PG 452 CG1407-PG 131..189 103..161 160 42.4 Plus
CG4483-PA 435 CG4483-PA 17..154 33..163 157 27.8 Plus
CG17287-PA 338 CG17287-PA 127..176 103..152 152 44 Plus
CG8314-PA 293 CG8314-PA 60..277 42..265 149 22.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20071-PA 241 GI20071-PA 1..241 44..288 814 64.1 Plus
Dmoj\GI18977-PA 282 GI18977-PA 9..282 16..288 668 43.1 Plus
Dmoj\GI18972-PA 271 GI18972-PA 2..251 21..278 411 33.2 Plus
Dmoj\GI18978-PA 275 GI18978-PA 26..261 33..278 397 36.8 Plus
Dmoj\GI10345-PA 308 GI10345-PA 32..306 23..287 351 37.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11193-PA 250 GL11193-PA 1..250 40..288 909 66.8 Plus
Dper\GL16922-PA 285 GL16922-PA 9..283 16..288 682 43.7 Plus
Dper\GL22296-PA 270 GL22296-PA 43..270 37..263 269 30.1 Plus
Dper\GL23902-PA 381 GL23902-PA 139..232 103..195 177 41.2 Plus
Dper\GL19029-PA 275 GL19029-PA 91..255 91..264 161 25.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18348-PA 250 GA18348-PA 1..250 40..288 909 66.8 Plus
Dpse\GA10260-PA 285 GA10260-PA 9..285 16..288 677 42.6 Plus
Dpse\GA10260-PB 256 GA10260-PB 9..238 16..240 518 39.6 Plus
Dpse\GA18553-PB 302 GA18553-PB 55..295 37..278 376 32.5 Plus
Dpse\GA27100-PA 381 GA27100-PA 139..232 103..195 177 41.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21456-PA 283 GM21456-PA 1..283 6..288 1457 96.8 Plus
Dsec\GM15639-PA 226 GM15639-PA 28..221 7..200 469 42.1 Plus
Dsec\GM10221-PA 288 GM10221-PA 46..280 43..286 399 36.8 Plus
Dsec\GM25666-PA 288 GM25666-PA 46..284 43..282 395 35.2 Plus
Dsec\GM10218-PA 302 GM10218-PA 45..296 24..277 383 32.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10954-PA 283 GD10954-PA 1..283 6..288 1482 98.2 Plus
Dsim\GD25128-PA 278 GD25128-PA 9..271 16..278 662 43.6 Plus
Dsim\GD14673-PA 288 GD14673-PA 46..284 43..282 412 36.5 Plus
Dsim\GD18169-PA 302 GD18169-PA 34..296 13..277 381 31.2 Plus
Dsim\GD18171-PA 276 GD18171-PA 26..276 27..283 373 33.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21165-PA 248 GJ21165-PA 1..248 37..288 954 67.1 Plus
Dvir\GJ19937-PA 287 GJ19937-PA 9..282 16..287 638 42.3 Plus
Dvir\GJ21996-PA 269 GJ21996-PA 9..260 16..278 462 36.8 Plus
Dvir\GJ19938-PA 213 GJ19938-PA 3..202 71..274 389 38.3 Plus
Dvir\GJ10196-PA 321 GJ10196-PA 54..312 36..281 364 34.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14088-PA 279 GK14088-PA 1..275 6..278 924 63 Plus
Dwil\GK20822-PA 269 GK20822-PA 9..264 16..277 594 42.2 Plus
Dwil\GK18990-PA 278 GK18990-PA 28..272 36..278 348 32 Plus
Dwil\GK18989-PA 273 GK18989-PA 42..267 55..277 337 35.1 Plus
Dwil\GK11281-PA 381 GK11281-PA 126..232 90..195 179 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12528-PA 283 GE12528-PA 1..283 6..288 1454 95.1 Plus
Dyak\GE11678-PA 278 GE11678-PA 9..271 16..278 652 43.2 Plus
Dyak\GE19883-PA 288 GE19883-PA 21..280 18..278 418 34.6 Plus
Dyak\GE10668-PA 276 GE10668-PA 26..267 27..278 399 36.3 Plus
Dyak\GE10667-PA 276 GE10667-PA 30..276 25..283 373 33.2 Plus

RT01106.hyp Sequence

Translation from 14 to 868

> RT01106.hyp
MMILRSWDRVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIW
YTLLWLASLFLIFNITSNMLACMLVDTSIRKELLKPPLDAAQLARWHSCQ
DCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMI
IGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLV
IYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLRGNLEMVLG
KRMHLTWLSPFLRSDLPHDGMNWEPIAAFSPKEE*

RT01106.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG4676-PA 284 CG4676-PA 1..284 1..284 1552 100 Plus
CG10344-PB 278 CG10344-PB 9..270 12..273 696 44.9 Plus
CG10344-PA 198 CG10344-PA 9..191 12..194 496 44.1 Plus
CG18810-PA 300 CG18810-PA 1..283 2..275 446 35.2 Plus
CG13029-PC 288 CG13029-PC 31..280 26..274 425 37.8 Plus