Clone RT01110 Report

Search the DGRC for RT01110

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:11
Well:10
Vector:pCR2.1
Associated Gene/TranscriptCrebB-RD
Protein status:RT01110.pep: wuzgold
Sequenced Size:1028

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6103 2006-05-19 RT target
CrebB-17A 2008-04-29 In process prior to 5.5
CrebB-17A 2008-08-15 Release 5.9 accounting
CrebB-17A 2008-12-18 5.12 accounting

Clone Sequence Records

RT01110.complete Sequence

1028 bp assembled on 2008-07-28

GenBank Submission: BT033069

> RT01110.complete
GAAGTTATCAGTCGACATGGACAACAGCATCGTCGAGGAGAACGGCAACT
CGTCGGCGGCATCGGGCTCCAATGACGTGGTCGATGTCGTTGCCCAACAG
GCGGCGGCAGCGGTGGGCGGCGGCGGTGGAGGAGGAGGAGGCGGCGGCGG
TGGTAACCCCCAGCAGCAGCAACAGAACCCACAAAGTACAACGGCCGGCG
GTCCAACGGGTGCGACGAACAACGCCCAGGGAGGCGGAGTGTCCTCCGTG
CTGACCACCACCGCCAACTGCAACATACAATACCCCATCCAGACGCTGGC
GCAGCACGGACTGCAGGTGCAGTCCGTGATACAGGCCAATCCCTCGGGAG
TCATACAGACAGCAGCTGGAACCCAGCAGCAGCAACAGGCGCTGGCCGCC
GCCACAGCGATGCAGAAGGTGGTCTACGTGGCCAAGCCGCCGAACTCGAC
GGTCATCCACACGACGCCTGGCAATGCAGTGCAAGTGCGTAACAAAATCC
CTCCAACCTTTCCGTGTAAGATCAAGCCCGAACCGAACACGCAGCACCCG
GAGGACAGCGACGAGAGTCTGTCGGACGACGATTCCCAGCACCACCGCAG
CGAGCTGACGCGACGGCCGTCGTACAATAAGATCTTCACCGAGATCAGCG
GTCCGGACATGAGCGGCGCATCGCTTCCCATGTCCGACGGCGTGCTCAAT
TCCCAGCTGGCGGGGACCGGAGCGGGGGGCAATGCGGCGAACAGCTCCCT
GATGCAATTGGATCCCACGTACTACCTGTCCAATCGGATGTCCTACAACA
CCAACAACAGCGGGATAGCGGAGGATCAGACCCGTAAGCGCGAGATCCGG
CTGCAGAAGAACAGGGAGGCGGCGCGTGAGTGCCGGCGCAAGAAGAAGGA
GTACATCAAGTGCCTGGAGAATCGAGTGGCGGTGCTAGAGAACCAAAACA
AAGCGCTCATCGAGGAGCTGAAGTCGCTCAAGGAGCTCTACTGTCAGACC
AAGAACGATTGAAAGCTTTATCGACCAT

RT01110.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
CrebB-17A-RD 1011 CrebB-17A-RD 14..1011 15..1012 4990 100 Plus
CrebB-17A-RE 1095 CrebB-17A-RE 400..1095 317..1012 3480 100 Plus
CrebB-17A.k 2823 CrebB-17A.k 1003..1521 495..1013 2595 100 Plus
CrebB-17A.k 2823 CrebB-17A.k 535..1004 15..484 2350 100 Plus
CrebB-17A-RE 1095 CrebB-17A-RE 14..318 15..319 1525 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18261308..18261612 15..319 1525 100 Plus
chrX 22417052 chrX 18265022..18265231 804..1013 1050 100 Plus
chrX 22417052 chrX 18262207..18262390 313..496 920 100 Plus
chrX 22417052 chrX 18262464..18262633 497..666 850 100 Plus
chrX 22417052 chrX 18264427..18264565 665..803 695 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:40:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18372131..18372435 15..319 1525 100 Plus
X 23542271 X 18375843..18376052 804..1013 1050 100 Plus
X 23542271 X 18373030..18373213 313..496 920 100 Plus
X 23542271 X 18373287..18373456 497..666 850 100 Plus
X 23542271 X 18375248..18375386 665..803 695 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18380229..18380533 15..319 1525 100 Plus
X 23527363 X 18383941..18384150 804..1013 1050 100 Plus
X 23527363 X 18381128..18381311 313..496 920 100 Plus
X 23527363 X 18381385..18381554 497..666 850 100 Plus
X 23527363 X 18383346..18383484 665..803 695 100 Plus
Blast to na_te.dros performed 2019-03-16 01:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..7001 161..392 140 59.2 Plus
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 7876..7925 558..605 110 72 Plus

RT01110.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:58:07 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18264428..18264565 666..803 100 -> Plus
chrX 18262211..18262390 317..496 100 -> Plus
chrX 18262464..18262632 497..665 100 -> Plus
chrX 18261447..18261609 154..316 100 -> Plus
chrX 18265022..18265231 804..1013 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:55:23 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RD 1..996 17..1012 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:38 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RD 1..996 17..1012 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:42:22 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-RD 1..996 17..1012 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:46:09 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RD 1..996 17..1012 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:52:12 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-RG 371..984 387..1012 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:23:30 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RD 1..1011 1..1012 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:38 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RD 1..1011 1..1012 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:42:22 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-RD 1..1012 1..1013 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:46:09 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-17A-RD 1..1011 1..1012 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:52:12 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
CrebB-RG 819..1433 387..1013 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:07 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
X 18372121..18372432 3..316 98 -> Plus
X 18373034..18373213 317..496 100 -> Plus
X 18373287..18373455 497..665 100 -> Plus
X 18375249..18375386 666..803 100 -> Plus
X 18375843..18376052 804..1013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:07 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
X 18372121..18372432 3..316 98 -> Plus
X 18373034..18373213 317..496 100 -> Plus
X 18373287..18373455 497..665 100 -> Plus
X 18375249..18375386 666..803 100 -> Plus
X 18375843..18376052 804..1013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:07 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
X 18372121..18372432 3..316 98 -> Plus
X 18373034..18373213 317..496 100 -> Plus
X 18373287..18373455 497..665 100 -> Plus
X 18375249..18375386 666..803 100 -> Plus
X 18375843..18376052 804..1013 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:42:22 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18269282..18269419 666..803 100 -> Plus
arm_X 18266154..18266465 3..316 98 -> Plus
arm_X 18267067..18267246 317..496 100 -> Plus
arm_X 18267320..18267488 497..665 100 -> Plus
arm_X 18269876..18270085 804..1013 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:31:47 Download gff for RT01110.complete
Subject Subject Range Query Range Percent Splice Strand
X 18380219..18380530 3..316 98 -> Plus
X 18381132..18381311 317..496 100 -> Plus
X 18381385..18381553 497..665 100 -> Plus
X 18383347..18383484 666..803 100 -> Plus
X 18383941..18384150 804..1013 100   Plus

RT01110.pep Sequence

Translation from 1 to 1011

> RT01110.pep
KLSVDMDNSIVEENGNSSAASGSNDVVDVVAQQAAAAVGGGGGGGGGGGG
GNPQQQQQNPQSTTAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLA
QHGLQVQSVIQANPSGVIQTAAGTQQQQQALAAATAMQKVVYVAKPPNST
VIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHRS
ELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSL
MQLDPTYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKE
YIKCLENRVAVLENQNKALIEELKSLKELYCQTKND*

RT01110.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22432-PA 203 GF22432-PA 9..203 140..336 809 91.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19161-PA 330 GG19161-PA 1..330 6..336 1644 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17726-PA 376 GH17726-PA 70..376 63..336 908 69.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
CrebB-PQ 331 CG6103-PQ 1..331 6..336 1705 100 Plus
CrebB-PN 327 CG6103-PN 1..327 6..336 1670 98.8 Plus
CrebB-PI 327 CG6103-PI 1..327 6..336 1670 98.8 Plus
CrebB-PG 327 CG6103-PG 1..327 6..336 1670 98.8 Plus
CrebB-PF 285 CG6103-PF 1..285 6..336 1409 85.8 Plus
CrebB-PP 281 CG6103-PP 1..281 6..336 1374 84.6 Plus
CrebB-PO 281 CG6103-PO 1..281 6..336 1374 84.6 Plus
CrebB-PJ 281 CG6103-PJ 1..281 6..336 1374 84.6 Plus
CrebB-PM 296 CG6103-PM 1..219 6..224 1129 99.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15475-PA 365 GI15475-PA 1..365 6..336 891 63.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26969-PA 323 GL26969-PA 1..323 6..336 1010 75.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22328-PA 318 GA22328-PA 1..318 6..336 1057 76.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22894-PA 310 GM22894-PA 31..310 55..336 1440 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17392-PA 315 GD17392-PA 1..310 6..317 1557 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19187-PA 242 GJ19187-PA 1..224 6..221 465 64.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20005-PA 337 GK20005-PA 76..337 83..336 891 80.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17723-PA 324 GE17723-PA 1..324 6..336 1630 95.2 Plus

RT01110.hyp Sequence

Translation from 3 to 1011

> RT01110.hyp
RIGNMDNSIVEENGNSSAASGSNDVVDVVAQQAAAAVGGGGGGGGGGGGG
NPQQQQQNPQSTTAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLAQ
HGLQVQSVIQANPSGVIQTAAGTQQQQQALAAATAMQKVVYVAKPPNSTV
IHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHRSE
LTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLM
QLDPTYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEY
IKCLENRVAVLENQNKALIEELKSLKELYCQTKND*

RT01110.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
CrebB-PN 327 CG6103-PN 1..327 5..335 1670 98.8 Plus
CrebB-PI 327 CG6103-PI 1..327 5..335 1670 98.8 Plus
CrebB-PG 327 CG6103-PG 1..327 5..335 1670 98.8 Plus
CrebB-PF 285 CG6103-PF 1..285 5..335 1409 85.8 Plus
CrebB-PP 281 CG6103-PP 1..281 5..335 1374 84.6 Plus